Table 1

Linear-B cell antigenic epitope prediction for TgCPB
Order Amino acid position Potential antigenic sequences Score
1 325–346 LMPLSAQHTTSCCNAIHCASFG 1.190
2 6–30 SFRVLGTPLPFAALAAILLLGCMYT 1.183
3 57–86 AEDVLNAFVSPESVESLFDSIVAEQVVATS 1.176
4 379–407 CWPYEVPFCAHHAKAPFPDCDATLVPRKT 1.175
5 118–127 GELLRLLLAD 1.170
6 147–160 RHIVRDSVLVSEKA 1.164
7 283–294 AFPACKDVVGHV 1.157
8 453–489 GPVSGAFMVYEDFLSYKSGVYKHVSGLPVGGHAIKII 1.153
9 196–204 SNAAVALIK 1.130
10 300–306 CGSCWAF 1.108
11 243–250 GTFLVNTK 1.103
12 225–236 EVSLRFRYLSLK 1.092
13 272–278 EPVPAHF 1.091
14 314–320 DRLCIRS 1.084
15 38–44 DSLFPLS 1.078
16 434–440 TSAYSLR 1.067
17 139–145 FRHLTHS 1.061
18 420–426 ADNVHPF 1.060
19 362–367 KGVVTG 1.055
20 260–265 MPLPAK 1.045
21 520–525 MGQCGI 1.039

Zhao et al.

Zhao et al. BMC Infectious Diseases 2013 13:207   doi:10.1186/1471-2334-13-207

Open Data