Table 1

Summary of antibodies tested on Western Blot

Antibody

Overexpressed mLRRK2

Overexpressed hLRRK2

Endogenous mLRRK2

Endogenous hLRRK2

Peptide Location


Abgent AP7099a

-

-

-

-

N/A

Abgent AP7099b

-

-

-

-

(LRR, AA 1246–1265, 100% identity)

H: WSRVEKLHLSHNKLKEIPPE

M: WSRVEKLHLSHNKLKEIPPE

Abgent AP7099c

-

-

-

-

(N-Term, around L229)

H: EEIVLHVLHCLHSLAIPCNNVEVLMSGNVR

M: KEIVYHVLCCLHSLAVTCSNVEVLMSGNVR

Abgent AP7099d

-

-

-

-

(N-Term, around E285)

H: VSCCLLHRLTLGNFFNILVLNEVHEFVVKA

M: VSCSLFQKLTLGNFFNILVLNEVHVFVVKA

Abgent AP7099e

-

+

-

+

(N-Term, around E519)

H: RAILHFIVPGMPEESREDTEFHHKLNMVKK

M: RAILHFVVPGLLEESRE..DSQCRPNVLRK

Abgent AP7099f

-

+

-

-

(N-Term, around L893)

H: AQSDDLDSEGSEGSFLVKKKSNSISVGEFY

M: GQSDDLDSEGSESSFLVKRKSNSISVGEVY

Abgent AP7099g

-

+

-

-

(N-Term, around L899)

H: AQSDDLDSEGSEGSFLVKKKSNSISVGEFY

M: GQSDDLDSEGSESSFLVKRKSNSISVGEVY

Abgent AP7099h

-

+

-

-

(N-Term, around L955)

H: IFDHEDLLKRKRKILSSDDSLRSSKLQSHM

M: VFDHEDLLRRKRKILSSDESLRSSRLPSHM

Abgent AP7099i

-

-

-

-

(C-Term, around C2354)

H: STERNVMWGGCGTKIFSFSNDFTIQKLIET

M: SSERHITWGGCGTKVFSFSNDFTIQKLIET

Abgent AP7099j

-

-

-

-

(C-Term, around K2402)

H: CVHFLREVMVKENKESKHKMSYSGRVKTLC

M: CVHFLKEVMVKLNKESKHQLSYSGRVKALC

Abgent AP7099k

-

-

-

-

(C-Term, around Y2475)

H: MTAQLGSLKNVMLVLGYNRKNTEGTQKQKE

M: ATAQLGSLKNVMLVLGYKRKSTEGIQEQKE

Abgent AM7099a

-

-

-

-

(monoclonal) N/A

Abgent AM7099b

-

-

-

-

(monoclonal) N/A

Abcam 27482

-

+

-

-

N/A

Abcam 19906

-

-

-

-

N/A

Novus Biological 267

-

+

-

+

(N-Term, AA 920–945)

H: SNSISVGEFYRDAVLQRCSPNLQRHS

M: SNSISVGEVYRDLALQRYSPNAQRHS

Novus Biological 268

-

+

-

+

(C-Term, AA 2500–2527)

H: INLPHEVQNLEKHIEVRKELAEKMRRTSVE

M: LNLPHEVQNLEKHIEVRTELADKMRKTSVE

Chemicon AB9682

-

+

-

-

N/A, synthetic peptide from rat

Chemicon AB9704

-

+

-

-

N/A

Alexis (AT106)

+

+

+

+

(AA 1838–2133)

Cell Signaling 2567

+

+

-

-

(C-Term, G2090)

H: FPNEFDELEIQGKLPDPVKEYGCAPWPMVE

M: FPNEFDELAIQGKLPDPVKEYGCAPWPMVE

JH5514

+

+

+

+

(C-Term, AA 2500–2515), 100% identity

H: INLPHEVQNLEKHIE

M: LNLPHEVQNLEKHIE


Summary of the results of commercially available antibodies against LRRK2 tested on Western Blot. A (+) denotes antibodies that produce a discernable band specific to LRRK2 protein. A (-) denotes antibodies unable to detect a band specific to LRRK2 protein. Antibodies were designed against the human sequence unless otherwise indicated.

Biskup et al. BMC Neuroscience 2007 8:102   doi:10.1186/1471-2202-8-102

Open Data