Table 3

Motif sequences identified by MEME tools

Motif

Multilevel consensus sequence


1

PKYFKHNNFSSFVRQLNTYGFRKIDPDRWEFANECFLRGQKHLLKNIHRRKP

2

NVLMQEVVKLRQQQQTTKWQMQAMEQRLQHMEQRQQQMMSFLAKVMQNP

3

PFLTKTYDMVDDPATDHVISWNEDN

4

SFVRQLNTYGFRKVDPDRWEFANECFLRGQKHLLCNIHRRK

5

SFVVWNPHEFARDLL

6

AGSCPAYADLMEENERLRRENARLTRELAHMKKLCNNIIYFMSNYVDPQQPDAAKAM

7

SGPAPFLTKTYQMVCDPATDHVISWGPCG

8

YFGYEEEIERLKRDK

9

AEINDDFWEQFLTEGPGCCE

10

EMRKELIDAISKKRRRPIDDC

11

SFVVWDPHAFSQTLL

12

YFKHNNFS

13

DNMDVLTEQMGYLSS

14

FLNQLVQQQRRSNWWNDDGNRKRRFQALEHGPVDDQETSGGGAQIIQYCPPVPETSNQPIPANEAFCSTPAQPVSSPALEMPMDV

15

DEDKCVKLFGVSIGDKRMRDH

16

QPWPIYRPRPVYHPIRPCNG

17

PQYQQQSVGSCVEVG

18

GGGGGGGG

19

AAAAAA

20

PMEGLHEVGPP

21

ASLDGQIVKYQPMINEAAK

22

TSFYDDHSSTSKQEMGNLLNQHFSDKLKLGLCPAMTESNIITLSTQSSHEDNGSPHGKHPDCDMMGMECLPLVPQMMELSDTGTSICPSKSVCFTPPINDDGFLPCHLNLTLASCPMDVDKSQIPDANGNTID

23

RCEEAAASERPIKMIRIGEPWIGVPSSGP

24

YDHPWLEQDCQMEAQQNCKNPQYADVIT

25

ELENLALNIQGLGKGKID

26

PEADDMGTGSSLEQGSPVLFEPQDPVEFLIDGIPSDLESSAVDAHGLIAPQDI

27

MDADDDERIWGVDASAALQSSCSGTSQQAYGSHVSDPYLMDIANKPEKFWELDFQALDDGDLQLDKCVIDDPALQQQ

28

MASNNVGTFDSTGNDFTDTSALCEWDDMDIFGGELEHILQQPEQDFQVDP

29

SPTYSGEEQVISSNS

30

AMLRKILKLDSSHRFESMGNSDN


Numbers correspond to the motifs described in Figure 4.

Lin et al. BMC Genomics 2011 12:76   doi:10.1186/1471-2164-12-76

Open Data