Additional file 4.

Alignment of protein sequences of SLC17A9 from various species. Alignment of protein sequences of SLC17A9 from human (hs, Homo sapiens), chicken (gg, Gallus gallus), puffer fish (tn, Tetraodon nigroviridis), fugu fish (tr, Takifugu rubripes), zebra fish (dr, Danio rerio), amphioxus (bf, Branchiostoma floridae), sea squirt (cs, Ciona savigyni), fruit fly (dm, Drosophila melanogaster) and round worm (ce, Caenorhabditis elegans). TM represents the predicted transmembrane regions. In the sea squirt (cs, Ciona savigyni), sequence X indicates the peptide sequence X:QGQLYLLYGVLDNELYNKFVICPQTFLFG.

Format: TIFF Size: 4MB Download file

Sreedharan et al. BMC Genomics 2010 11:17   doi:10.1186/1471-2164-11-17