Open Access Research article

Glutamate, aspartate and nucleotide transporters in the SLC17 family form four main phylogenetic clusters: evolution and tissue expression

Smitha Sreedharan1, Jafar HA Shaik1, Pawel K Olszewski12, Allen S Levine23, Helgi B Schiöth1 and Robert Fredriksson1*

Author Affiliations

1 Department of Neuroscience, Functional Pharmacology, Uppsala University, BMC, Uppsala SE 75124, Sweden

2 Minnesota Obesity Center, Department of Food Science and Nutrition, Saint Paul, MN 55108, USA

3 Department of Food Science and Nutrition, Saint Paul, MN 55108, USA

For all author emails, please log on.

BMC Genomics 2010, 11:17  doi:10.1186/1471-2164-11-17

Published: 8 January 2010

Additional files

Additional file 1:

Primer sequences. PCR primers used for the quantitative realtime PCR assays.

Format: DOC Size: 33KB Download file

This file can be viewed with: Microsoft Word Viewer

Open Data

Additional file 2:

Expression of the SLC17 family in mouse according to the Allen Brain Atlas resource[53]. Expression levels of the SLC17 family sequences in mouse brain. Numbers between 0 (no expression) and 100 (highest expression) are derived from the database using the Expression Level feature.

Format: DOC Size: 42KB Download file

This file can be viewed with: Microsoft Word Viewer

Open Data

Additional file 3:

Alignment of dm Slc17a10 and the all human SLC17 sequences. Alignment of protein sequences from human (hs, Homo sapiens) hsSLC17A1-17A9 and fruit fly (dm, Drosophila melanogaster) dmSlc17a10. TM represents the predicted transmembrane regions.

Format: TIFF Size: 4.6MB Download file

Open Data

Additional file 4:

Alignment of protein sequences of SLC17A9 from various species. Alignment of protein sequences of SLC17A9 from human (hs, Homo sapiens), chicken (gg, Gallus gallus), puffer fish (tn, Tetraodon nigroviridis), fugu fish (tr, Takifugu rubripes), zebra fish (dr, Danio rerio), amphioxus (bf, Branchiostoma floridae), sea squirt (cs, Ciona savigyni), fruit fly (dm, Drosophila melanogaster) and round worm (ce, Caenorhabditis elegans). TM represents the predicted transmembrane regions. In the sea squirt (cs, Ciona savigyni), sequence X indicates the peptide sequence X:QGQLYLLYGVLDNELYNKFVICPQTFLFG.

Format: TIFF Size: 4MB Download file

Open Data