Table 5

Major motifs in Arabidopsis and rice IQD proteins

Motifa

Multilevel consensus sequenceb


1

EEWAAIKIQTAFRGYLARRALRALKGLVRLQALVRGHLVRKQAAMTLRCMQALVRVQAQVRR

2

MGKKGKWFKSLFGGF

3

SWFTAVKRIFISPTK

4

NKKWKLWRTSSED

5

EKRRWSFRKSS

6

PPCPPPPPPHH

7

KHAIAVAIATAAAAEAAVAAA

8

QAAAEVVRLTS

9

SEENQALQKQLHQKHHHE

10

GEDWDDSILSK

11

EEIEAKLQMRQEAAIKRERAMAYAFSHQW

12

WKNSSKTGNPTFMDP

13

DNPNWGWNWLERWMA

14

ARPWENRLMDD

15

YEENPKIVEMDTGKPYY

16

GSMNDDESFTSCPDF

17

PNYMANTESAKAKVRCQSAPR

18

SAKKRLSFPN

19

DHVKEIEEGWCDSIG

20

WMEKLTNNAFADKLLASSPTTLPLH


a Numbers (1–20) correspond to the motifs schematically presented in the reference bars of Figure 3. Motif 1 corresponds to the IQ67 consensus sequence. The remaining motifs are listed in the order as they occur in the primary structures of IQD proteins, continuing with motifs most N-terminal.

b Sequences were obtained from the MEME analysis of the 61 Arabidopsis and rice IQD full length proteins. Only consensus sequences that are shared by at least four Arabidopsis IQD proteins are listed.

Abel et al. BMC Evolutionary Biology 2005 5:72   doi:10.1186/1471-2148-5-72

Open Data