Table 3

Prediction of the nuclear and mitochondrial targeting sequences in tRNase ZLs from flowering plants

Protein name

From

Nuc

Mito

Predicted mitochondrial targeting sequences


AcoTrz3

AcoTrzL1

N

-

AcoTrz4

AcoTrzL2

-

M

MPQISSNLKLFFSKTNHSPLFQFSFKASFCSSFLLSSKTPYKPLSSVTVISSSSSSSSSSRKGPKFPPLRSRS (73)

AlyTrz3

AlyTrzL1

N

M

MINSMPYLHKNLRLLLLLSSKSSPFPLSLRPFSPRSFSLSTLFS (44)

AlyTrz4

AlyTrzL2

N

M

MLTSSMPHRHVPQNLSLFGFSPLKSSSFALFLRPFSLYPPIFASSSPSPSRRPPRTAGYRRS (62)

AthTrz3

AthTrzL1

N

M

MINSMPYLHKNLRLLRLLSSKSSPFPLSLRPFSPRSFSLSTLFS (44)

AthTrz4

AthTrzL2

N

M

MLTSSMPQNLSLFGFSPLKSSSFALILRPFSLYPPIFASSSPAPSRRPPRTAGYRRSGPSPPRRK (65)

BdiTrz3

BdiTrzL1

-

M

MPQVAAPLRLLLPLSQTLAPPAPLLHLSRRLLSFCSPASFRRAASLRALAYRRSRHPEPRRG (62)

CpaTrz3

CpaTrzL1

N

M

MFLIYPNLRLLLNPPLFLFSKPNSTPLSLFTVFASSSHKRHRSVSYRDSPFGLHRRRRNFTTFKERD (67)

CclTrz3

CclTrzL1

N

M

MPFITPNLRLLFSSSSSSLFPLKLSVPLLSTKPTNRHRSLFTILSYSKRQRSTPFPQQNQRRN (63)

CsiTrz3

CsiTrzL1

N

M

MPFITPNLRLLFSSSSSSSLFPLKLSVPLLSTKPTNRHHSLFTILSYSKRQRSTPFPQQNQRRN(64)

CsaTrz3

CsaTrzL1

N

M

MPLPHLSTLRFLFFSPSKLPFSPSLYSPKSHSLFTVLASSPPKRRRSATAPPSLNFKRRN (60)

EgrTrz3

EgrTrzL1

N

M

MPCVYSNLRLLFSSSATAAAATATAAASPFLSPLKLKLRRPSSSSSAFPLLPLPPLSSLRS (61)

GmaTrz3

GmaTrzL1

N

M

MAQVSKFGYFLLHSSLPKPSNIQFRSLLTVLASSSKRHRRK (41)

GmaTrz4

GmaTrzL2

N

M

MAQVSKFGHLLLHSSLPKPSNSNIQFRSLLTLLASSSKRHRSIPPFRRKS (50)

MesTrz3

MesTrzL1

N

M

MPQISNLRFLLSPIKPSLPFPFSKPKPYSLFTVLCSSSSSRRHRTTPNHQSLNFRSRS (58)

MesTrz4

MesTrzL2

-

M

MPNVLNFKLCLSDLLTQCCKICLQHYILTFSSLSHVLVSGKLQSSNPQTYFSINNPLPRSKNSRT (65)

MtrTrz3

MtrTrzL1

N

M

MAQILNFRNFLFLPSYKPTTHFRLRFLSTLVSSSSRRSNINAPPLHLRRRS (51)

MguTrz3

MguTrzL1

N

M

MPQSTNLRLLLSSANCHRRHPFSAASNFFPKHLSFSSSFQFFLKPQFKTREIPLLFATFSSYSKKPYATNNNSNNNNKNSRSFNRN (86)

OsaTrz3

OsaTrzL1

-

M

MPQLPSPLRRLLPLSQTLAAATPAPLLHLSRRLFSSSSSPSPSPSPRAACLRALAYRGGQAGGGGRRGHHNNLLRRG (77)

PtrTrz3

PtrTrzL1

N

M

MSHISNLRLLLSPLNPTLRFPFSSKHRPYSLLTILSSSSPYPKRRHRTTPNHPSLNFRSRS (61)

PpeTrz3

PpeTrzL1

N

M

MPQVTNLRLLFFSPFPRLSLSSLSFKPLKPRTLFTALASSYRKRHRPIPNQSPNTGARN (59)

SitTrz5

SitTrzL1

-

M

MPQVAAPLRLLLPLSQTLAPAPLLHLSRRLFTSSSPSFGRAASLRALAYRRHHHPRRGSSTLRK (64)

SbiTrz4

SbiTrzL1

N

M

MPQVAGPLRRLLPLSQTLASAPAPLLHLSRRLLSSCSPASFGRAASLRALAYRRRRHPEPRRG (63)

VviTrz3

VviTrzL1

N

M

MPHLTSFRLLYCSPLLSPFKSPFLSFSTLSKSKSPLLNPPSFFTVLSSSSGRYPKLRRHPHHLRRRN (67)

ZmaTrz3

ZmaTrzL1

N

M

MPQVAAPLRLLLPLSQTLAAPAPLLHHSRRLLSSCPASLSRAAGLRALAYRRRRHTEPRRG (61)


The putative nuclear localization signals were predicted using PSORT http://psort.hgc.jp/form.html webcite, while the putative mitochondrial targeting signals were predicted using MITOPROT http://ihg2.helmholtz-muenchen.de/ihg/mitoprot.html webcite. Nuc: stand for the nucleus; Mito: mitochondria. N indicates nuclear localization and M denotes mitochondrial localization. "-", the localization could not be predicted. The numbers refer to amino acid positions starting from the N-terminus.

Fan et al. BMC Evolutionary Biology 2011 11:219   doi:10.1186/1471-2148-11-219

Open Data