Table 1

List of predicted CK1 sites present among identified CK1-responsive phospho-sites
Protein description Site sequence Gene ID Closest human relative E mi Accession Alters Hs clock? Rhythmic in Mm?
Upregulated in both lines: ** ***
1 L-asparaginase-like S(p)LGLLPGPTK Ot13g02360 L-asparaginase 1e-35 34% AAH35836.1 Yes (τ, A) Yes (l, a, ba, ag)
2 Armadillo/plakoglobin AAS(p)AEIASDYVATPGGSR Ot15g02430 Uridine-Cytidine Kinase 1-like 3e-20 32% EAW75186.1 - Yes (ba, a, d)
3 PI-4-phosphate 5-kinase LRSS(p)VANVTAFATEEPL Ot02g07550 PI-4-phosphate 5-kinase 2e-06 23% AAC50916.1 Yes (τ, A) Yes (h, k, a, n)
4 Ankyrin repeats protein AMQRGSS(p)LLDLQSADGGTPAMSAAAHSYGDVLQYLIEK Ot08g01070 Ankyrin repeat domain 17 2e-05 38% AAH43394.1 Yes (τ, A) Yes (bs, l, n, h, s)
5 unnamed protein product ASTLNDST(p)ADDGNVVR Ot07g03300 Ankyrin/Armadillo repeats protein 0.014 24% EAX10893.1 - -
6 unnamed protein product EAFGDAS(p)DDDAFSPR Ot14g01520 Poliovirus receptor-related 4 1.6 32% BAG61075.1 Yes (τ, A) Yes (n, d)
7 unnamed protein product ET(p1)KT(p2,3)LAELMS(p3)INMGA* Ot04g00360 RNF181 1.8 42% CCQ43543.1 - -
8 unnamed protein product GGQEGS(p)PSKSLSSPK Ot14g02110 No similarity found N/A N/A N/A N/A N/A
9 unnamed protein product ALEDES(p)PVAVVKEK Ot01g02950 No similarity found N/A N/A N/A N/A N/A
10 unnamed protein product TKDAAEAS(p)DEDVVATR Ot01g02280 No similarity found N/A N/A N/A N/A N/A
Upregulated in tau only:
11 CDPK SES(p)FAILTEAAK Ot10g01030 Death-associated protein kinase 3 2e-37 31% NP_001339.1 Yes (τ, A) Yes (d, lu, hy)
Upregulated in CK1-OX8 only:
12 Phox AIS(p)PAPEER Ot05g00090 Sorting nexin 1, phox domain 4e-13 22% NP_003090.2 Yes (τ, A) Yes (d, l)
13 Trehalose-phosphate synthase PADGST(p)PESPPRR Ot01g02410 H+ transporting ATPase 5.8 35% EAW99791.1 Yes (τ) Yes (lu, k, h)
Not differentially regulated in either overexpression line:
14 putative TAF6 RNA polymerase GT(p)TPDDDIGDAAAAHAPNVAVAETHV Ot13g00540 TAF6 RNA polymerase II 4e-65 34% EAW76588.1 Yes (τ, A) Yes (l, s, p, ag)
15 unnamed protein product APAGAKPGITLPSNPFAAKPAT(p)KATPAAK Ot14g01370 Unknown protein 2e-38 40% AAH53854.1 - -
16 unnamed protein product FGIVDGS(p)ASTETPETFVK Ot08g03890 Spondin 1 0.36 25% AAH19825.1 Yes (τ) Yes (lu, n, d)
17 unnamed protein product ALASDS(p)EDDERPR Ot04g04920 Importin beta 1.1 38% NP001263382.1 - -
18 unnamed protein product TAS(p)PMTSPMASPSPAD Ot17g01690 2,3-bisphosphoglycerate mutase 9.2 33% BAD92281.1 Yes (τ, A) Yes (n, sm, p, d)
19 unnamed protein product SAS(p)YDSLLGAVPASTFPRPIPLAEMVR Ot15g00280 No similarity found N/A N/A N/A N/A N/A

List of CK1 sites based on site prediction that are present in the phospho-preoteome observed in this study and [18]. Parent proteins are listed for each peptide, along with their closest homolog in the human genome. Results are listed based on 1) their presence in significantly differentially regulated sites, and 2) Goodness of homology to closest human ortholog identified by BLAST searches. E values (E) and Maximum Identity (MI) are based on NCBI Blast. *This peptide is identified in three different phosphorylation states (p1, p2, p3), and all three are upregulated upon overexpression of either allele. ** [34], effects on period (t) and/or amplitude (A) upon knock-down in human cells. *** [36-41], rhythmic expression in following mouse cell types: liver (l), aorta (a), brown adipose (ba), adrenal gland (ag), distal colon (d), heart (h), kidney (k), NIH3T3 (n), brain stem (bs), SCN (s), lung (lu), hypothalamus (hy), pituitary (p), skeletal muscle (sm).

van Ooijen et al.

van Ooijen et al. BMC Cell Biology 2013 14:46   doi:10.1186/1471-2121-14-46

Open Data