Table 1

Predicted antigenic sites and their lengths using Bepipred [29]and IEDB [28]analysis tools
Bepipred analysis IEDB analysis
Peptide Length (aa) Peptide Length (aa)
VRPGNFNQ 8 DYKVQLFEKYFKY 13
GNAAIT 6 HANCVNCTDDRCVLHCANFNVLFAM 25
DKSAGHPFN 9 KTCFGPIVRKIFVDGVPFVVSCGYHYKELGLV 32
SYQEQ 5 VSLHRHRLSLK 11
DVDNP 5 ADPAMHI 7
YPKCDRA 7 SSNAFLDLRTSCFSVAALTTG 21
YYVKPGGTSSGDATTAY 17 YDFVVSKG 8
SVTLKHFFFA 10
DYNYYSYN 8
PTMCDIKQMLFCMEVVNKYFEI 22
DGGCLNASEVVVNN 14
KARVYYESM 9
LKYAIS 6
TVAGVSILS 9
GATCVIGTT 9
LKTLYKDV 8
YPKCDRA 7
CRIFASLILARKHGTCCTT 19
YRLANECAQVLSEYVLCGGGYYVKPG 26
ANSVFNILQA 10
TANVSAL 7

Sharmin and Islam

Sharmin and Islam BMC Bioinformatics 2014 15:161   doi:10.1186/1471-2105-15-161

Open Data