Command line Training Set First Motif Summary of Motifs Termination Explanation


Search sequence databases with these motifs using MAST.
Submit these motifs to BLOCKS multiple alignment processor.
Build and use a motif-based hidden Markov model (HMM) using Meta-MEME.


MEME - Motif discovery tool

MEME version 3.5.7 (Release date: 2007-12-17 16:56:19 -0800 (Mon, 17 Dec 2007))

For further information on how to interpret these results or to get a copy of the MEME software please access http://meme.nbcr.net.

This file may be used as input to the MAST algorithm for searching sequence databases for matches to groups of motifs. MAST is available for interactive use and downloading at http://meme.nbcr.net.


REFERENCE

If you use this program in your research, please cite:

Timothy L. Bailey and Charles Elkan, "Fitting a mixture model by expectation maximization to discover motifs in biopolymers", Proceedings of the Second International Conference on Intelligent Systems for Molecular Biology, pp. 28-36, AAAI Press, Menlo Park, California, 1994.


TRAINING SET

DATAFILE= secondpass.twoline.faa
ALPHABET= ACDEFGHIKLMNPQRSTVWY
Sequence name            Weight Length  Sequence name            Weight Length  
-------------            ------ ------  -------------            ------ ------  
gi|157691589|BPUM_0807|Y 1.0000    200  gi|163940708|BcerKBAB4_2 1.0000     35  
gi|239827399|GWCH70_2031 1.0000    831  gi|229916702|EAT1b_0975| 1.0000    180  
gi|229917217|EAT1b_1492| 1.0000    101  gi|56964615|ABC2851|YP_1 1.0000    220  
gi|49477012|BT9727_0859| 1.0000    199  gi|261409914|GYMC10_6143 1.0000    524  
gi|56963278|ABC1513|YP_1 1.0000    151  gi|261407639|GYMC10_3840 1.0000    582  
gi|163119564|BL05276|YP_ 1.0000     82  gi|169827149|Bsph_1579|Y 1.0000    271  
gi|15615679|BH3117|NP_24 1.0000    230  gi|52080136|BL02256|YP_0 1.0000    259  
gi|52082396|BL00940|YP_0 1.0000    177  gi|295696140|Btus_1522|Y 1.0000    242  
gi|296504786|BMB171_C395 1.0000    375  gi|154686587|RBAM_021560 1.0000    255  
gi|288555607|BpOF4_12995 1.0000    235  gi|295702333|BMD_0117|YP 1.0000    216  
gi|301056170|BACI_c46590 1.0000    181  gi|295695225|Btus_0554|Y 1.0000    209  
gi|239826640|GWCH70_1138 1.0000    254  gi|169829522|Bsph_4082|Y 1.0000    180  
gi|52783954|BLi00116|YP_ 1.0000    223  gi|138895828|GTNG_2187|Y 1.0000    181  
gi|154685119|RBAM_006640 1.0000    165  gi|15613235|BH0672|NP_24 1.0000    285  
gi|296502433|BMB171_C159 1.0000    112  gi|301055395|BACI_c38600 1.0000    238  
gi|52786504|BLi02769|YP_ 1.0000    241  gi|169828833|Bsph_3367|Y 1.0000    172  
gi|296501752|BMB171_C091 1.0000    206  gi|169828654|Bsph_3171|Y 1.0000    154  
gi|261409324|GYMC10_5549 1.0000    256  gi|56964009|ABC2244|YP_1 1.0000    254  
gi|15615785|BH3223|NP_24 1.0000    242  gi|169827019|Bsph_1443|Y 1.0000    204  
gi|295695669|Btus_1025|Y 1.0000    206  gi|15613939|BH1376|NP_24 1.0000    372  
gi|229917220|EAT1b_1495| 1.0000    186  gi|261405575|GYMC10_1726 1.0000    182  
gi|212638647|Aflv_0804|Y 1.0000    129  gi|297529299|GC56T3_0955 1.0000    245  
gi|301053373|BACI_c17850 1.0000    160  gi|296503062|BMB171_C223 1.0000    177  
gi|301053967|BACI_c23980 1.0000    289  gi|261419324|GYMC61_1900 1.0000    239  
gi|261409365|GYMC10_5592 1.0000    229  gi|67078088|pE33L466_021 1.0000    323  
gi|261409537|GYMC10_5766 1.0000    214  gi|23100228|OB2773|NP_69 1.0000    188  
gi|239826355|GWCH70_0832 1.0000    245  gi|297530579|GC56T3_2307 1.0000    251  
gi|261404502|GYMC10_0633 1.0000    176  gi|295706363|BMD_4258|YP 1.0000    239  
gi|288556053|BpOF4_15235 1.0000    176  gi|15616444|BH3882|NP_24 1.0000    154  
gi|15614178|BH1615|NP_24 1.0000    176  gi|295695629|Btus_0984|Y 1.0000    246  
gi|297530706|GC56T3_2446 1.0000    239  gi|296501706|BMB171_C086 1.0000    176  
gi|295696809|Btus_2226|Y 1.0000    195  gi|295695448|Btus_0783|Y 1.0000    379  
gi|261405990|GYMC10_2143 1.0000    251  gi|23098557|OB1102|NP_69 1.0000    242  
gi|301055076|BACI_c35350 1.0000    177  gi|169830054|Bsph_4638|Y 1.0000    215  
gi|172056123|Exig_0079|Y 1.0000    213  gi|138896056|GTNG_2419|Y 1.0000    375  
gi|56965809|ABC4051|YP_1 1.0000    179  gi|169829726|Bsph_4295|Y 1.0000    261  
gi|169826679|Bsph_1097|Y 1.0000    180  gi|52787569|BLi03891|YP_ 1.0000    201  
gi|15613848|BH1285|NP_24 1.0000    235  gi|297529579|GC56T3_1250 1.0000    181  
gi|52080250|BL01246|YP_0 1.0000    254  gi|294499031|BMQ_2272|YP 1.0000    159  
gi|229918653|EAT1b_2940| 1.0000    256  gi|16079737|BSU26840|NP_ 1.0000    176  
gi|261417590|GYMC61_0090 1.0000    238  gi|169828091|Bsph_2568|Y 1.0000    177  
gi|56961818|ABC0036|YP_1 1.0000    246  gi|294501280|BMQ_4542|YP 1.0000    377  
gi|15612678|BH0115|NP_24 1.0000    217  gi|23098724|OB1269|NP_69 1.0000    174  
gi|52785627|BLi01868|YP_ 1.0000    254  gi|261406063|GYMC10_2217 1.0000    197  
gi|297585316|Bsel_3049|Y 1.0000    175  gi|52078665|BL02699|YP_0 1.0000    187  
gi|23097558|OB0103|NP_69 1.0000    217  gi|294499631|BMQ_2875|YP 1.0000    176  
gi|297528524|GC56T3_0148 1.0000    190  gi|169827296|Bsph_1728|Y 1.0000    173  
gi|154685410|RBAM_009760 1.0000    163  gi|169826467|Bsph_0879|Y 1.0000    182  
gi|261406207|GYMC10_2363 1.0000    178  gi|23099399|OB1944|NP_69 1.0000    380  
gi|261406707|GYMC10_2870 1.0000    200  gi|301054766|BACI_c32210 1.0000    183  
gi|154684616|RBAM_001230 1.0000    218  gi|154685892|RBAM_014590 1.0000    173  
gi|301056717|BACI_c52440 1.0000    156  gi|301054926|BACI_c33840 1.0000    240  
gi|169826213|Bsph_0618|Y 1.0000    182  gi|56964116|ABC2351|YP_1 1.0000    237  
gi|296503330|BMB171_C249 1.0000    228  gi|229917493|EAT1b_1768| 1.0000    173  
gi|23099294|OB1839|NP_69 1.0000    250  gi|297582861|Bsel_0539|Y 1.0000    268  
gi|261417856|GYMC61_0374 1.0000    252  gi|295705020|BMD_2904|YP 1.0000    176  
gi|296504831|BMB171_C400 1.0000    196  gi|295695806|Btus_1170|Y 1.0000    238  
gi|295696440|Btus_1834|Y 1.0000    256  gi|301054311|BACI_c27530 1.0000    228  
gi|261405623|GYMC10_1774 1.0000    377  gi|301051831|BACI_c01200 1.0000    218  
gi|297582431|Bsel_0096|Y 1.0000    184  gi|261405539|GYMC10_1690 1.0000    233  
gi|261419325|GYMC61_1901 1.0000    259  gi|138895880|GTNG_2239|Y 1.0000    252  
gi|295706259|BMD_4154|YP 1.0000    253  gi|297582645|Bsel_0319|Y 1.0000    166  
gi|261405165|GYMC10_1312 1.0000    180  gi|23100115|OB2660|NP_69 1.0000    187  
gi|239826532|GWCH70_1030 1.0000    239  gi|52784408|BLi00595|YP_ 1.0000    165  
gi|15615117|BH2554|NP_24 1.0000    261  gi|261407370|GYMC10_3567 1.0000    183  
gi|218896653|BCG9842_B36 1.0000     87  gi|157694260|BPUM_3514|Y 1.0000    176  
gi|261406097|GYMC10_2252 1.0000    204  gi|23099454|OB1999|NP_69 1.0000    234  
gi|52081127|BL02107|YP_0 1.0000    241  gi|288554248|BpOF4_06145 1.0000    170  
gi|172058539|Exig_2532|Y 1.0000    181  gi|157691684|BPUM_0902|Y 1.0000    163  
gi|172057862|Exig_1853|Y 1.0000    257  gi|229917375|EAT1b_1650| 1.0000    213  
gi|15613183|BH0620|NP_24 1.0000    177  gi|261419010|GYMC61_1575 1.0000    193  
gi|239827600|GWCH70_2250 1.0000    250  gi|56962021|ABC0239|YP_1 1.0000    187  
gi|288556276|BpOF4_16370 1.0000    184  gi|294509114|BMQ_pBM5002 1.0000    176  
gi|294501013|BMQ_4269|YP 1.0000    259  gi|261404792|GYMC10_0928 1.0000    216  
gi|297582696|Bsel_0370|Y 1.0000    187  gi|169829980|Bsph_4562|Y 1.0000    181  
gi|157691562|BPUM_0780|Y 1.0000    188  gi|172057556|Exig_1543|Y 1.0000    175  
gi|23098930|OB1475|NP_69 1.0000    239  gi|261405674|GYMC10_1825 1.0000    260  
gi|295702393|BMD_0187|YP 1.0000    187  gi|296504397|BMB171_C356 1.0000    259  
gi|138894662|GTNG_0992|Y 1.0000    239  gi|52786447|BLi02712|YP_ 1.0000    373  
gi|297529524|GC56T3_1195 1.0000    252  gi|52080819|BL00651|YP_0 1.0000    194  
gi|297582547|Bsel_0215|Y 1.0000    185  gi|218848158|BCG9842_003 1.0000    295  
gi|261406353|GYMC10_2510 1.0000    406  gi|23100811|OB3356|NP_69 1.0000    195  
gi|157691239|BPUM_0446|Y 1.0000    262  gi|157690881|BPUM_0083|Y 1.0000    218  
gi|261404258|GYMC10_0386 1.0000    299  gi|297531625|GC56T3_3410 1.0000    256  
gi|295695216|Btus_0545|Y 1.0000    186  gi|295702435|BMD_0229|YP 1.0000    264  
gi|294498927|BMQ_2164|YP 1.0000    164  gi|261404968|GYMC10_1112 1.0000    308  
gi|154685949|RBAM_015160 1.0000    260  gi|23097683|OB0228|NP_69 1.0000    187  
gi|294509181|BMQ_pBM5009 1.0000    220  gi|295706676|BMD_4577|YP 1.0000    242  
gi|52079432|BL02851|YP_0 1.0000    163  gi|261404314|GYMC10_0444 1.0000    170  
gi|138896469|GTNG_2832|Y 1.0000    143  gi|157692422|BPUM_1642|Y 1.0000     77  
gi|157690957|BPUM_0160|Y 1.0000    195  gi|56963560|ABC1795|YP_1 1.0000    254  
gi|288555708|BpOF4_13500 1.0000    176  gi|296505675|BMB171_C484 1.0000    156  
gi|23099768|OB2313|NP_69 1.0000    155  gi|172056208|Exig_0164|Y 1.0000    181  
gi|295705661|BMD_3546|YP 1.0000    170  gi|218897389|BCG9842_B29 1.0000     37  
gi|218235233|BCB4264_A18 1.0000    112  gi|261417650|GYMC61_0150 1.0000    190  
gi|15616194|BH3632|NP_24 1.0000    320  gi|297528465|GC56T3_0089 1.0000    227  
gi|157694452|BPUM_3710|Y 1.0000    164  gi|154684695|RBAM_002260 1.0000    187  
gi|157693076|BPUM_2309|Y 1.0000    289  gi|296502728|BMB171_C189 1.0000    192  
gi|157692810|BPUM_2042|Y 1.0000    202  gi|154686555|RBAM_021240 1.0000    194  
gi|52079008|BL02208|YP_0 1.0000    263  gi|261407775|GYMC10_3981 1.0000    316  
gi|52785264|BLi01499|YP_ 1.0000    251  gi|288553151|BpOF4_00625 1.0000    237  
gi|296506459|BMB171_P007 1.0000    323  gi|52786234|BLi02495|YP_ 1.0000    255  
gi|15615778|BH3216|NP_24 1.0000    193  gi|56963737|ABC1972|YP_1 1.0000    176  
gi|52786190|BLi02449|YP_ 1.0000    194  gi|296503941|BMB171_C311 1.0000    235  
gi|172056180|Exig_0136|Y 1.0000    187  gi|52080135|BL02255|YP_0 1.0000    239  
gi|261408152|GYMC10_4361 1.0000    244  gi|172056869|Exig_0832|Y 1.0000    361  
gi|301053658|BACI_c20780 1.0000    192  gi|23099037|OB1582|NP_69 1.0000    258  
gi|172058807|Exig_2804|Y 1.0000    265  gi|288556282|BpOF4_16400 1.0000    178  
gi|229917800|EAT1b_2078| 1.0000    266  gi|163119552|BL03682|YP_ 1.0000    373  
gi|239827809|GWCH70_2471 1.0000    236  gi|52784380|BLi00560|YP_ 1.0000    264  
gi|295696452|Btus_1846|Y 1.0000    261  gi|261409476|GYMC10_5703 1.0000    188  
gi|154685948|RBAM_015150 1.0000    239  gi|301055785|BACI_c42620 1.0000    375  
gi|295706482|BMD_4377|YP 1.0000    253  gi|52785509|BLi01750|YP_ 1.0000    239  
gi|52785449|BLi01689|YP_ 1.0000    171  gi|157691378|BPUM_0588|Y 1.0000    181  
gi|56963382|ABC1617|YP_1 1.0000    235  gi|296504398|BMB171_C356 1.0000    239  
gi|294500640|BMQ_3893|YP 1.0000    166  gi|169829158|Bsph_3702|Y 1.0000    375  
gi|52082452|BL01923|YP_0 1.0000    182  gi|52785510|BLi01751|YP_ 1.0000    259  
gi|297584063|Bsel_1770|Y 1.0000    253  gi|23098931|OB1476|NP_69 1.0000    260  
gi|296502978|BMB171_C214 1.0000    289  gi|294501329|BMQ_4591|YP 1.0000    242  
gi|261418447|GYMC61_0982 1.0000    245  gi|261404205|GYMC10_0333 1.0000    162  
gi|294497070|BMQ_0235|YP 1.0000    264  gi|288555754|BpOF4_13730 1.0000    372  
gi|154686781|RBAM_023510 1.0000    373  gi|294501135|BMQ_4391|YP 1.0000    253  
gi|154687094|RBAM_026660 1.0000    171  gi|52784792|BLi01020|YP_ 1.0000    163  
gi|157693020|BPUM_2253|Y 1.0000    373  gi|15615924|BH3362|NP_24 1.0000    183  
gi|295704098|BMD_1970|YP 1.0000    188  gi|261405228|GYMC10_1376 1.0000    172  
gi|169827960|Bsph_2435|Y 1.0000    159  gi|301053341|BACI_c17530 1.0000    188  
gi|294500554|BMQ_3807|YP 1.0000    224  gi|16080921|BSU38700|NP_ 1.0000    178  
gi|296504567|BMB171_C373 1.0000    252  gi|138894925|GTNG_1263|Y 1.0000    173  
gi|288553039|BpOF4_00065 1.0000    257  gi|297582430|Bsel_0095|Y 1.0000    214  
gi|288554854|BpOF4_09205 1.0000    261  gi|23100547|OB3092|NP_69 1.0000    179  
gi|154685755|RBAM_013220 1.0000    248  gi|261406734|GYMC10_2897 1.0000    191  
gi|15615119|BH2556|NP_24 1.0000    237  gi|297582837|Bsel_0515|Y 1.0000    178  
gi|15614101|BH1538|NP_24 1.0000    252  gi|30019875|BC1731|NP_83 1.0000    112  
gi|229917320|EAT1b_1595| 1.0000    191  gi|23098703|OB1248|NP_69 1.0000    163  
gi|295704351|BMD_2228|YP 1.0000    159  gi|301055830|BACI_c43070 1.0000    181  
gi|239826131|GWCH70_0591 1.0000    186  gi|157693526|BPUM_2772|Y 1.0000    172  
gi|15612826|BH0263|NP_24 1.0000    187  gi|52078593|BL03273|YP_0 1.0000    223  
gi|288554775|BpOF4_08800 1.0000    187  gi|296500928|BMB171_C009 1.0000    219  
gi|229916320|EAT1b_0589| 1.0000    364  gi|261409306|GYMC10_5531 1.0000    185  
gi|138893768|GTNG_0089|Y 1.0000    216  gi|295694818|Btus_0134|Y 1.0000    221  
gi|56420261|GK1726|YP_14 1.0000    161  gi|294497991|BMQ_1224|YP 1.0000    236  
gi|296504096|BMB171_C326 1.0000    177  gi|261404455|GYMC10_0586 1.0000    166  
gi|239827752|GWCH70_2414 1.0000    374  gi|52785094|BLi01326|YP_ 1.0000    167  
gi|296505785|BMB171_C495 1.0000    175  gi|15613092|BH0529|NP_24 1.0000    261  
gi|52784027|BLi00199|YP_ 1.0000    187  gi|138894663|GTNG_0993|Y 1.0000    264  
gi|56963455|ABC1690|YP_1 1.0000    373  gi|56964115|ABC2350|YP_1 1.0000    261  
gi|295703274|BMD_1138|YP 1.0000    163  gi|229916805|EAT1b_1078| 1.0000    147  
gi|288555447|BpOF4_12185 1.0000    182  gi|294500913|BMQ_4167|YP 1.0000    253  
gi|294500560|BMQ_3813|YP 1.0000    216  gi|52787848|BLi04171|YP_ 1.0000    189  
gi|157692018|BPUM_1237|Y 1.0000    251  gi|295706362|BMD_4257|YP 1.0000    259  
gi|42780194|BCE_1118|NP_ 1.0000    180  gi|301052754|BACI_c11460 1.0000    161  
gi|261406105|GYMC10_2260 1.0000    163  gi|294497028|BMQ_0193|YP 1.0000    187  
gi|301055569|BACI_c40400 1.0000    252  gi|152977630|Bcer98_3970 1.0000    183  
gi|138893826|GTNG_0147|Y 1.0000    162  gi|239825735|GWCH70_0154 1.0000    183  
gi|295705913|BMD_3805|YP 1.0000    216  gi|288553150|BpOF4_00620 1.0000    261  
gi|296502401|BMB171_C156 1.0000    188  gi|52788043|BLi04371|YP_ 1.0000    285  
gi|239826533|GWCH70_1031 1.0000    259  gi|23098085|OB0630|NP_69 1.0000    263  
gi|294498777|BMQ_2014|YP 1.0000    188  gi|301052678|BACI_c10700 1.0000    177  
gi|261406442|GYMC10_2604 1.0000    193  gi|295705907|BMD_3799|YP 1.0000    221  
gi|138896107|GTNG_2470|Y 1.0000    237  gi|261408790|GYMC10_5011 1.0000    234  
gi|154685132|RBAM_006770 1.0000    177  gi|67077986|pE33L466_010 1.0000    162  
gi|138894489|GTNG_0819|Y 1.0000    246  gi|169827020|Bsph_1444|Y 1.0000    257  
gi|52080075|BL02968|YP_0 1.0000    171  gi|169827905|Bsph_2380|Y 1.0000    172  
gi|294496966|BMQ_0119|YP 1.0000    216  gi|239825676|GWCH70_0094 1.0000    216  
gi|261404562|GYMC10_0696 1.0000    172  gi|297582968|Bsel_0647|Y 1.0000    185  
gi|239827551|GWCH70_2200 1.0000    182  gi|218902444|BCAH820_132 1.0000    179  
gi|152976319|Bcer98_2607 1.0000    242  gi|52080862|BL00778|YP_0 1.0000    255  
gi|218232506|BCB4264_A54 1.0000     59  gi|56962590|ABC0816|YP_1 1.0000    261  
gi|288556517|BpOF4_17595 1.0000    163  gi|169829956|Bsph_4538|Y 1.0000    157  
gi|15614589|BH2026|NP_24 1.0000    179  gi|294500314|BMQ_3558|YP 1.0000    170  
gi|23098753|OB1298|NP_69 1.0000    175  gi|169827282|Bsph_1714|Y 1.0000    195  
gi|169829306|Bsph_3856|Y 1.0000    228  gi|288555440|BpOF4_12150 1.0000    168  
gi|15614994|BH2431|NP_24 1.0000    256  gi|157692327|BPUM_1546|Y 1.0000    255  
gi|52079036|BL05045|YP_0 1.0000    165  gi|154686064|RBAM_016310 1.0000    254  
gi|261420836|GYMC61_3488 1.0000    256  gi|294497918|BMQ_1151|YP 1.0000    163  
gi|261417657|GYMC61_0157 1.0000    375  gi|297583869|Bsel_1572|Y 1.0000    184  
gi|297529352|GC56T3_1008 1.0000    375  gi|288554708|BpOF4_08465 1.0000    215  
gi|301054038|BACI_c24720 1.0000    177  gi|297531020|GC56T3_2772 1.0000    193  
gi|138897001|GTNG_3372|Y 1.0000    258  gi|52079892|BL03529|YP_0 1.0000    251  
gi|154684976|RBAM_005070 1.0000    262  gi|157692208|BPUM_1427|Y 1.0000    259  
gi|261406319|GYMC10_2476 1.0000    263  gi|157692844|BPUM_2076|Y 1.0000    255  
gi|296501716|BMB171_C087 1.0000    257  gi|295696987|Btus_2417|Y 1.0000    188  
gi|295703345|BMD_1209|YP 1.0000    236  gi|261404422|GYMC10_0553 1.0000    180  
gi|295694956|Btus_0276|Y 1.0000    197  gi|154686834|RBAM_024040 1.0000    240  
gi|56961915|ABC0133|YP_1 1.0000    220  gi|295705993|BMD_3885|YP 1.0000    167  
gi|261405039|GYMC10_1184 1.0000    155  gi|261405673|GYMC10_1824 1.0000    240  
gi|52082178|BL04030|YP_0 1.0000    201  gi|42779274|BCE_0193|NP_ 1.0000    114  
gi|288555973|BpOF4_14835 1.0000    256  gi|301052635|BACI_c10250 1.0000    258  
gi|261409947|GYMC10_6177 1.0000    162  gi|218905476|BCAH820_436 1.0000    100  
gi|295706627|BMD_4528|YP 1.0000    377  gi|301055394|BACI_c38590 1.0000    289  
gi|52079725|BL03831|YP_0 1.0000    167  gi|295696453|Btus_1847|Y 1.0000    242  
gi|52787786|BLi04109|YP_ 1.0000    177  gi|42783741|BCE_4695|NP_ 1.0000     81  
gi|261419446|GYMC61_2030 1.0000    251  gi|297584635|Bsel_2346|Y 1.0000    371  
gi|295694973|Btus_0293|Y 1.0000    185  gi|169829988|Bsph_4570|Y 1.0000    187  
gi|297530705|GC56T3_2445 1.0000    259  gi|301056831|BACI_c53580 1.0000    175  
gi|52082644|BL00106|YP_0 1.0000    285  gi|261407955|GYMC10_4162 1.0000    262  
gi|301054256|BACI_c26970 1.0000    176  gi|261407440|GYMC10_3639 1.0000    286  
gi|297582728|Bsel_0402|Y 1.0000    181  gi|16078537|BSU14730|NP_ 1.0000    173  
gi|294500199|BMQ_3443|YP 1.0000    177  gi|157692207|BPUM_1426|Y 1.0000    239  
gi|261404261|GYMC10_0389 1.0000    177  gi|294501014|BMQ_4270|YP 1.0000    239  
gi|138894766|GTNG_1100|Y 1.0000    253  gi|261417910|GYMC61_0428 1.0000    181  
gi|261406462|GYMC10_2625 1.0000    197  gi|138894123|GTNG_0449|Y 1.0000    180  
gi|295704249|BMD_2121|YP 1.0000    164  gi|217960836|BCAH187_A34 1.0000    872  
gi|154685691|RBAM_012580 1.0000    170  gi|23097664|OB0209|NP_69 1.0000    170  
gi|56419662|GK1127|YP_14 1.0000    239  gi|49186524|BAS3522|YP_0 1.0000    167  
gi|56420843|GK2308|YP_14 1.0000    250  gi|218897485|BCG9842_B28 1.0000    177  
gi|49186821|BAS3823|YP_0 1.0000    314  gi|161611198|GBAA2970|YP 1.0000    192  
gi|255767137|BSU04730|NP 1.0000    262  gi|218901842|BCAH820_070 1.0000    185  
gi|49478442|BT9727_3646| 1.0000    239  gi|118479803|BALH_4240|Y 1.0000    181  
gi|218902920|BCAH820_180 1.0000    188  gi|49187552|BAS4558|YP_0 1.0000    181  
gi|118479123|BALH_3533|Y 1.0000    289  gi|52143630|BCZK1605|YP_ 1.0000    160  
gi|218232753|BCB4264_A21 1.0000    192  gi|163941644|BcerKBAB4_3 1.0000    239  
gi|225862624|BCA_0684|YP 1.0000    185  gi|229604251|BAA_4924|YP 1.0000    181  
gi|163938900|BcerKBAB4_0 1.0000    257  gi|229601980|BAA_3517|YP 1.0000    235  
gi|229602836|BAA_1861|YP 1.0000    160  gi|229602282|BAA_3022|YP 1.0000    192  
gi|49481307|BT9727_4032| 1.0000    373  gi|163940993|BcerKBAB4_3 1.0000    166  
gi|218234226|BCB4264_A16 1.0000    179  gi|30263538|BA3649|NP_84 1.0000    169  
gi|229603990|BAA_4316|YP 1.0000    252  gi|152976482|Bcer98_2771 1.0000    252  
gi|222095431|BCQ_1771|YP 1.0000    188  gi|163941054|BcerKBAB4_3 1.0000    176  
gi|229604408|BAA_2852|YP 1.0000    228  gi|47530932|GBAA5610|YP_ 1.0000    175  
gi|163941815|BcerKBAB4_3 1.0000    252  gi|227813430|BAMEG_0833| 1.0000    167  
gi|52141585|BCZK3662|YP_ 1.0000    289  gi|218899057|BCG9842_B12 1.0000    259  
gi|118478833|BALH_3229|Y 1.0000    177  gi|49183986|BAS0964|YP_0 1.0000    206  
gi|227817068|BAMEG_4554| 1.0000    373  gi|229601988|BAA_2511|YP 1.0000    289  
gi|118475937|BALH_0169|Y 1.0000    164  gi|49186754|BAS3755|YP_0 1.0000    239  
gi|30022159|BC4072|NP_83 1.0000    252  gi|218234749|BCB4264_A40 1.0000    239  
gi|47529862|GBAA4566|YP_ 1.0000    237  gi|225866273|BCA_4403|YP 1.0000    373  
gi|229604897|BAA_2557|YP 1.0000    177  gi|49188088|BAS5102|YP_0 1.0000    146  
gi|222094400|BCQ_0714|YP 1.0000    185  gi|52141944|BCZK3297|YP_ 1.0000    177  
gi|218234415|BCB4264_A46 1.0000    181  gi|118477262|BALH_1573|Y 1.0000    160  
gi|49479940|BT9727_1587| 1.0000    188  gi|229604778|BAA_1124|YP 1.0000    177  
gi|49187190|BAS4194|YP_0 1.0000    373  gi|218897120|BCG9842_B31 1.0000    192  
gi|118476332|BALH_0588|Y 1.0000    185  gi|217960990|BCAH187_A36 1.0000    177  
gi|218901372|BCAH820_019 1.0000    163  gi|47529811|GBAA4515|YP_ 1.0000    373  
gi|47530811|GBAA5493|YP_ 1.0000    146  gi|227815388|BAMEG_2801| 1.0000    160  
gi|118479762|BALH_4199|Y 1.0000    169  gi|52144286|BCZK0942|YP_ 1.0000    177  
gi|163938949|BcerKBAB4_0 1.0000    177  gi|217961783|BCAH187_A44 1.0000    375  
gi|163938569|BcerKBAB4_0 1.0000    185  gi|218896095|BCG9842_B42 1.0000    177  
gi|30263235|BA3324|NP_84 1.0000    166  gi|162382776|BALH_3534|Y 1.0000    239  
gi|222096033|BCQ_2373|YP 1.0000    289  gi|42780162|BCE_1086|NP_ 1.0000    257  
gi|52143656|BCZK1578|YP_ 1.0000    188  gi|52141808|BCZK3438|YP_ 1.0000    167  
gi|222098834|BCQ_5203|YP 1.0000    177  gi|218896772|BCG9842_B35 1.0000    160  
gi|30260357|BA0169|NP_84 1.0000    163  gi|52141167|BCZK4084|YP_ 1.0000    237  
gi|222094769|BCQ_1107|YP 1.0000    156  gi|229601723|BAA_5636|YP 1.0000    175  
gi|49183638|BAS0613|YP_0 1.0000    185  gi|218905890|BCAH820_477 1.0000    171  
gi|49186087|BAS3082|YP_0 1.0000    166  gi|227813739|BAMEG_1143| 1.0000    235  
gi|229604117|BAA_3359|YP 1.0000    166  gi|218897813|BCG9842_B24 1.0000    228  
gi|225866598|BCA_4732|YP 1.0000    169  gi|218903912|BCAH820_279 1.0000    228  
gi|47778165|GBAA3483|YP_ 1.0000    240  gi|49184640|BAS1626|YP_0 1.0000    188  
gi|30018830|BC0647|NP_83 1.0000    185  gi|49477092|BT9727_1012| 1.0000    161  
gi|52144214|BCZK1013|YP_ 1.0000    161  gi|49183127|BAS0093|YP_0 1.0000    218  
gi|49186981|BAS3983|YP_0 1.0000    252  gi|218898683|BCG9842_B16 1.0000    177  
gi|49183950|BAS0928|YP_0 1.0000    258  gi|52140841|BCZK4409|YP_ 1.0000    171  
gi|222096292|BCQ_2632|YP 1.0000    228  gi|222098082|BCQ_4424|YP 1.0000    169  
gi|229601998|BAA_3677|YP 1.0000    177  gi|16078710|BSU16470|NP_ 1.0000    254  
gi|47525427|GBAA0169|YP_ 1.0000    163  gi|218903588|BCAH820_247 1.0000    289  
gi|218903264|BCAH820_214 1.0000    192  gi|212639538|Aflv_1712|Y 1.0000    243  
gi|30263977|BA4115|NP_84 1.0000    299  gi|16078597|BSU15330|NP_ 1.0000    260  
gi|225864098|BCA_2202|YP 1.0000    192  gi|222093937|BCQ_0193|YP 1.0000    163  
gi|30262761|BA2789|NP_84 1.0000    228  gi|52140312|BCZK4947|YP_ 1.0000    156  
gi|218231966|BCB4264_A10 1.0000    177  gi|163942391|BcerKBAB4_4 1.0000    181  
gi|16078321|BSU12560|NP_ 1.0000    169  gi|49480184|BT9727_0913| 1.0000    258  
gi|30265385|BA5610|NP_84 1.0000    175  gi|56420789|GK2254|YP_14 1.0000    181  
gi|49186753|BAS3754|YP_0 1.0000    289  gi|222096241|BCQ_2581|YP 1.0000    176  
gi|30261806|BA1753|NP_84 1.0000    188  gi|222097523|BCQ_3863|YP 1.0000    252  
gi|30021993|BC3904|NP_83 1.0000    239  gi|49476711|BT9727_0090| 1.0000    218  
gi|218234550|BCB4264_A41 1.0000    252  gi|49477520|BT9727_1945| 1.0000    192  
gi|30023393|BC5363|NP_83 1.0000    176  gi|42784415|BCE_5370|NP_ 1.0000    156  
gi|118479464|BALH_3885|Y 1.0000    373  gi|212638699|Aflv_0856|Y 1.0000    372  
gi|49479242|BT9727_2287| 1.0000    179  gi|16077241|BSU01730|NP_ 1.0000    187  
gi|225864413|BCA_2518|YP 1.0000    289  gi|49481088|BT9727_1636| 1.0000    160  
gi|218904561|BCAH820_344 1.0000    235  gi|42784367|BCE_5322|NP_ 1.0000    190  
gi|217959667|BCAH187_A22 1.0000    192  gi|218233483|BCB4264_A24 1.0000    289  
gi|163939932|BcerKBAB4_1 1.0000    192  gi|218902955|BCAH820_183 1.0000    160  
gi|163939613|BcerKBAB4_1 1.0000    182  gi|42780290|BCE_1215|NP_ 1.0000    161  
gi|49478518|BT9727_3813| 1.0000    252  gi|217959293|BCAH187_A18 1.0000    188  
gi|227813895|BAMEG_1301| 1.0000    166  gi|217958581|BCAH187_A11 1.0000    257  
gi|217958232|BCAH187_A07 1.0000    185  gi|49186236|BAS3231|YP_0 1.0000    240  
gi|52143741|BCZK1493|YP_ 1.0000    179  gi|52140200|BCZK5060|YP_ 1.0000    177  
gi|222097349|BCQ_3689|YP 1.0000    289  gi|30261838|BA1789|NP_84 1.0000    160  
gi|163938169|BcerKBAB4_0 1.0000    163  gi|227813580|BAMEG_0984| 1.0000    177  
gi|30264150|BA4294|NP_84 1.0000    252  gi|225862220|BCA_0212|YP 1.0000    164  
gi|222094730|BCQ_1068|YP 1.0000    257  gi|225865247|BCA_3356|YP 1.0000    166  
gi|16077166|BSU00980|NP_ 1.0000    218  gi|227817453|BAMEG_4945| 1.0000    171  
gi|163941195|BcerKBAB4_3 1.0000    177  gi|30260800|BA0646|NP_84 1.0000    185  
gi|163940227|BcerKBAB4_2 1.0000    289  gi|222096073|BCQ_2413|YP 1.0000    177  
gi|218232155|BCB4264_A06 1.0000    185  gi|118480394|BALH_4859|Y 1.0000    207  
gi|163942610|BcerKBAB4_4 1.0000    176  gi|42783467|BCE_4421|NP_ 1.0000    265  
gi|217958692|BCAH187_A12 1.0000    161  gi|47778237|GBAA4042|YP_ 1.0000    259  
gi|218899234|BCG9842_B10 1.0000    252  gi|218231038|BCB4264_A01 1.0000    219  
gi|227812842|BAMEG_0200| 1.0000    163  gi|30262499|BA2502|NP_84 1.0000    177  
gi|229601447|BAA_4069|YP 1.0000    239  gi|163938101|BcerKBAB4_0 1.0000    219  
gi|225865393|BCA_3504|YP 1.0000    239  gi|42782657|BCE_3607|NP_ 1.0000    169  
gi|16079402|BSU23450|NP_ 1.0000    255  gi|30264411|BA4566|NP_84 1.0000    237  
gi|152977451|Bcer98_3783 1.0000    156  gi|218895700|BCG9842_B46 1.0000    185  
gi|30020915|BC2794|NP_83 1.0000    228  gi|229601909|BAA_0109|YP 1.0000    218  
gi|118477845|BALH_2188|Y 1.0000    289  gi|212639788|Aflv_1962|Y 1.0000    174  
gi|152975676|Bcer98_1911 1.0000    227  gi|163941043|BcerKBAB4_3 1.0000    240  
gi|225863696|BCA_1798|YP 1.0000    160  gi|152976769|Bcer98_3065 1.0000    237  
gi|49478708|BT9727_4352| 1.0000    169  gi|222097044|BCQ_3384|YP 1.0000    169  
gi|161486563|BA2970|NP_8 1.0000    192  gi|30021529|BC3426|NP_83 1.0000    239  
gi|225865885|BCA_4007|YP 1.0000    259  gi|47777889|GBAA1032|YP_ 1.0000    177  
gi|30020599|BC2469|NP_83 1.0000    179  gi|218904082|BCAH820_296 1.0000    192  
gi|30019159|BC1004|NP_83 1.0000    258  gi|49185332|BAS2323|YP_0 1.0000    179  
gi|222097350|BCQ_3690|YP 1.0000    239  gi|218897390|BCG9842_B29 1.0000    232  
gi|42781261|BCE_2195|NP_ 1.0000    192  gi|218900489|BCG9842_B54 1.0000    175  
gi|218902186|BCAH820_106 1.0000    257  gi|255767573|BSU25200|NP 1.0000    371  
gi|222095915|BCQ_2255|YP 1.0000    166  gi|30022417|BC4336|NP_83 1.0000    240  
gi|225866059|BCA_4185|YP 1.0000    252  gi|225864707|BCA_2814|YP 1.0000    176  
gi|218232533|BCB4264_A11 1.0000    161  gi|218900375|BCG9842_B55 1.0000    156  
gi|56421017|GK2482|YP_14 1.0000    375  gi|218905033|BCAH820_391 1.0000    259  
gi|30260284|BA0093|NP_84 1.0000    218  gi|47527079|GBAA1789|YP_ 1.0000    160  
gi|49186388|BAS3383|YP_0 1.0000    177  gi|163942050|BcerKBAB4_4 1.0000    375  
gi|217958624|BCAH187_A12 1.0000    177  gi|218904716|BCAH820_360 1.0000    177  
gi|163943299|BcerKBAB4_5 1.0000    194  gi|217959947|BCAH187_A25 1.0000    289  
gi|218895229|BCG9842_B52 1.0000    219  gi|217959319|BCAH187_A19 1.0000    160  
gi|118479504|BALH_3926|Y 1.0000    271  gi|49183204|BAS0171|YP_0 1.0000    163  
gi|222094839|BCQ_1177|YP 1.0000    161  gi|42780931|BCE_1861|NP_ 1.0000    160  
gi|163942935|BcerKBAB4_5 1.0000    156  gi|163940286|BcerKBAB4_2 1.0000    177  
gi|47527408|GBAA2114|YP_ 1.0000    192  gi|227816114|BAMEG_3540| 1.0000    177  
gi|118479276|BALH_3690|Y 1.0000    252  gi|218899507|BCG9842_B07 1.0000    237  
gi|49477062|BT9727_0953| 1.0000    177  gi|49477843|BT9727_2501| 1.0000    176  
gi|163940540|BcerKBAB4_2 1.0000    214  gi|217961326|BCAH187_A39 1.0000    239  
gi|227816040|BAMEG_3466| 1.0000    161  gi|217962148|BCAH187_A47 1.0000    171  
gi|30021992|BC3903|NP_83 1.0000    259  gi|49477707|BT9727_2248| 1.0000    289  
gi|47525925|GBAA0646|YP_ 1.0000    185  gi|163939015|BcerKBAB4_1 1.0000    161  
gi|52145050|BCZK0162|YP_ 1.0000    163  gi|222095751|BCQ_2091|YP 1.0000    192  
gi|49185764|BAS2758|YP_0 1.0000    192  gi|118477553|BALH_1878|Y 1.0000    201  
gi|229602177|BAA_4068|YP 1.0000    259  gi|225863070|BCA_1159|YP 1.0000    161  
gi|30020245|BC2108|NP_83 1.0000    192  gi|225862980|BCA_1069|YP 1.0000    177  
gi|52145123|BCZK0089|YP_ 1.0000    218  gi|52144667|BCZK0557|YP_ 1.0000    185  
gi|152976724|Bcer98_3019 1.0000    373  gi|42784537|BCE_5492|NP_ 1.0000    175  
gi|42783844|BCE_4798|NP_ 1.0000    181  gi|227816852|BAMEG_4334| 1.0000    252  
gi|30022370|BC4289|NP_83 1.0000    375  gi|47528023|GBAA2732|YP_ 1.0000    176  
gi|229601254|BAA_0200|YP 1.0000    163  gi|16079766|BSU27120|NP_ 1.0000    166  
gi|212637996|Aflv_0147|Y 1.0000    187  gi|222095458|BCQ_1798|YP 1.0000    160  
gi|218231149|BCB4264_A44 1.0000    237  gi|42782997|BCE_3949|NP_ 1.0000    239  
gi|163942095|BcerKBAB4_4 1.0000    237  gi|52144331|BCZK0896|YP_ 1.0000    258  
gi|49481227|BT9727_4932| 1.0000    146  gi|118476614|BALH_0889|Y 1.0000    258  
gi|47529410|GBAA4115|YP_ 1.0000    299  gi|52143032|BCZK2206|YP_ 1.0000    289  
gi|217959200|BCAH187_A17 1.0000    179  gi|47526271|GBAA0992|YP_ 1.0000    257  
gi|229603576|BAA_5520|YP 1.0000    156  gi|30261116|BA0992|NP_84 1.0000    257  
gi|47529588|GBAA4294|YP_ 1.0000    252  gi|217961324|BCAH187_A39 1.0000    259  
gi|42782494|BCE_3441|NP_ 1.0000    235  gi|225866320|BCA_4450|YP 1.0000    237  
gi|222098712|BCQ_5081|YP 1.0000    144  gi|229603088|BAA_2796|YP 1.0000    176  
gi|218233874|BCB4264_A10 1.0000    176  gi|255767497|BSU23100|NP 1.0000    194  
gi|229602244|BAA_1827|YP 1.0000    188  gi|52141583|BCZK3663|YP_ 1.0000    239  
gi|229601154|BAA_4536|YP 1.0000    373  gi|47527745|GBAA2454|YP_ 1.0000    289  
gi|56419467|GK0932|YP_14 1.0000    246  gi|217962852|BCAH187_A55 1.0000    177  
gi|227815422|BAMEG_2835| 1.0000    188  gi|218898488|BCG9842_B18 1.0000    239  
gi|217962100|BCAH187_A47 1.0000    169  gi|217961829|BCAH187_A44 1.0000    237  
gi|227817116|BAMEG_4602| 1.0000    237  gi|49478801|BT9727_4602| 1.0000    176  
gi|30262453|BA2454|NP_84 1.0000    289  gi|227812767|BAMEG_0109| 1.0000    218  
gi|42783188|BCE_4142|NP_ 1.0000    252  gi|218905848|BCAH820_473 1.0000    169  
gi|227818128|BAMEG_5654| 1.0000    175  gi|229600567|BAA_4139|YP 1.0000    314  
gi|218230792|BCB4264_A17 1.0000    188  gi|30018364|BC0114|NP_82 1.0000    219  
gi|52142720|BCZK2519|YP_ 1.0000    228  gi|30264734|BA4913|NP_84 1.0000    181  
gi|225867344|BCA_5512|YP 1.0000    175  gi|218903856|BCAH820_274 1.0000    176  
gi|217962737|BCAH187_A54 1.0000    156  gi|229601329|BAA_3825|YP 1.0000    167  
gi|218231851|BCB4264_A24 1.0000    177  gi|229604478|BAA_1086|YP 1.0000    257  
gi|30263905|BA4042|NP_84 1.0000    259  gi|227816152|BAMEG_3579| 1.0000    257  
gi|152977601|Bcer98_3939 1.0000    176  gi|212638845|Aflv_1004|Y 1.0000    247  
gi|47528609|GBAA3324|YP_ 1.0000    166  gi|218905429|BCAH820_431 1.0000    373  
gi|218899458|BCG9842_B08 1.0000    375  gi|49478441|BT9727_3645| 1.0000    289  
gi|222097738|BCQ_4079|YP 1.0000    375  gi|229602397|BAA_1198|YP 1.0000    161  
gi|30262135|BA2114|NP_84 1.0000    192  gi|42779174|BCE_0093|NP_ 1.0000    219  
gi|52141420|BCZK3829|YP_ 1.0000    252  gi|225862940|BCA_1029|YP 1.0000    257  
gi|42780207|BCE_1131|NP_ 1.0000    177  gi|225862146|BCA_0122|YP 1.0000    218  
gi|47527789|GBAA2502|YP_ 1.0000    177  gi|49476853|BT9727_0558| 1.0000    185  
gi|218902311|BCAH820_119 1.0000    161  gi|52142270|BCZK2972|YP_ 1.0000    166  
gi|212639647|Aflv_1821|Y 1.0000    239  gi|227814227|BAMEG_1635| 1.0000    192  
gi|218905533|BCAH820_441 1.0000    149  gi|227813117|BAMEG_0515| 1.0000    314  
gi|163941361|BcerKBAB4_3 1.0000    167  gi|218896046|BCG9842_B42 1.0000    176  
gi|212638503|Aflv_0658|Y 1.0000    166  gi|56419663|GK1128|YP_14 1.0000    259  
gi|152976264|Bcer98_2552 1.0000    259  gi|118477234|BALH_1540|Y 1.0000    188  
gi|218233191|BCB4264_A47 1.0000    171  gi|47528934|GBAA3649|YP_ 1.0000    169  
gi|218904418|BCAH820_330 1.0000    166  gi|218901296|BCAH820_010 1.0000    218  
gi|163941643|BcerKBAB4_3 1.0000    292  gi|52142997|BCZK2243|YP_ 1.0000    179  
gi|30263679|BA3803|NP_84 1.0000    167  gi|56419781|GK1246|YP_14 1.0000    251  
gi|30265276|BA5493|NP_84 1.0000    146  gi|227814399|BAMEG_1807| 1.0000    228  
gi|218231054|BCB4264_A34 1.0000    239  gi|30020517|BC2386|NP_83 1.0000    289  
gi|221316967|BCQ_PT45|YP 1.0000    166  gi|218900006|BCG9842_B02 1.0000    137  
gi|217961566|BCAH187_A42 1.0000    252  gi|227814737|BAMEG_2147| 1.0000    289  
gi|227813187|BAMEG_0585| 1.0000    259  gi|218903633|BCAH820_251 1.0000    177  
gi|163939640|BcerKBAB4_1 1.0000    181  gi|56421070|GK2535|YP_14 1.0000    237  
gi|118478099|BALH_2454|Y 1.0000    176  gi|225865571|BCA_3683|YP 1.0000    177  
gi|218896055|BCG9842_B42 1.0000    257  gi|30264362|BA4515|NP_84 1.0000    373  
gi|222098134|BCQ_4476|YP 1.0000    181  gi|47529336|GBAA4043|YP_ 1.0000    239  
gi|217959986|BCAH187_A25 1.0000    177  gi|225865886|BCA_4008|YP 1.0000    239  
gi|217957669|BCAH187_A01 1.0000    218  gi|52142105|BCZK3137|YP_ 1.0000    240  
gi|30021690|BC3589|NP_83 1.0000    177  gi|47525348|GBAA0093|YP_ 1.0000    218  
gi|222096892|BCQ_3232|YP 1.0000    235  gi|118478149|BALH_2506|Y 1.0000    231  
gi|49477300|BT9727_1502| 1.0000    179  gi|47530207|GBAA4913|YP_ 1.0000    181  
gi|30263906|BA4043|NP_84 1.0000    239  gi|222095341|BCQ_1681|YP 1.0000    179  
gi|218906540|BCAH820_545 1.0000    175  gi|16078017|BSU09520|NP_ 1.0000    163  
gi|49184672|BAS1658|YP_0 1.0000    160  gi|218233406|BCB4264_A40 1.0000    259  
gi|227818013|BAMEG_5539| 1.0000    156  gi|218896738|BCG9842_B35 1.0000    188  
gi|225863663|BCA_1765|YP 1.0000    188  gi|52143316|BCZK1921|YP_ 1.0000    192  
gi|222097784|BCQ_4125|YP 1.0000    263  gi|227814691|BAMEG_2101| 1.0000    177  
gi|218905035|BCAH820_391 1.0000    239  gi|118475864|BALH_0093|Y 1.0000    218  
gi|49185294|BAS2285|YP_0 1.0000    289  gi|217959830|BCAH187_A24 1.0000    166  
gi|163942349|BcerKBAB4_4 1.0000    169  gi|218232670|BCB4264_A10 1.0000    257  
gi|42783418|BCE_4372|NP_ 1.0000    375  gi|52142774|BCZK2466|YP_ 1.0000    176  
gi|42781877|BCE_2820|NP_ 1.0000    228  gi|42781595|BCE_2534|NP_ 1.0000    177  
gi|218899058|BCG9842_B12 1.0000    239  gi|49185553|BAS2545|YP_0 1.0000    176  
gi|49187232|BAS4236|YP_0 1.0000    237  gi|227814455|BAMEG_1863| 1.0000    176  
gi|225864766|BCA_2873|YP 1.0000    228  gi|42779792|BCE_0714|NP_ 1.0000    185  
gi|30023283|BC5251|NP_83 1.0000    156  gi|49188198|BAS5212|YP_0 1.0000    175  
gi|49478105|BT9727_3026| 1.0000    166  gi|152973941|Bcer98_0088 1.0000    220  
gi|152976265|Bcer98_2553 1.0000    239  gi|49481728|BT9727_3204| 1.0000    240  
gi|49185607|BAS2600|YP_0 1.0000    228  gi|47529087|GBAA3803|YP_ 1.0000    167  
gi|47526385|GBAA1113|YP_ 1.0000    161  gi|225867222|BCA_5390|YP 1.0000    156  
gi|49481469|BT9727_4074| 1.0000    237  gi|52141207|BCZK4042|YP_ 1.0000    373  
gi|227813186|BAMEG_0584| 1.0000    239  gi|218905210|BCAH820_409 1.0000    252  
gi|218896153|BCG9842_B41 1.0000    161  gi|218234396|BCB4264_A27 1.0000    228  
gi|229603531|BAA_0728|YP 1.0000    185  gi|229602619|BAA_2180|YP 1.0000    192  
gi|42782996|BCE_3948|NP_ 1.0000    289  gi|217960231|BCAH187_A28 1.0000    228  
gi|49184977|BAS1966|YP_0 1.0000    192  gi|218231535|BCB4264_A37 1.0000    177  
gi|227816484|BAMEG_3941| 1.0000    185  gi|222093864|BCQ_0107|YP 1.0000    218  
gi|49479125|BT9727_2552| 1.0000    228  gi|56421959|GK3424|YP_14 1.0000    256  
gi|118478695|BALH_3081|Y 1.0000    248  gi|163939522|BcerKBAB4_1 1.0000    181  
gi|212639646|Aflv_1820|Y 1.0000    259  gi|118477905|BALH_2250|Y 1.0000    180  
gi|49184055|BAS1035|YP_0 1.0000    161  gi|16078409|BSU13450|NP_ 1.0000    251  
gi|218906428|BCAH820_534 1.0000    156  gi|30019842|BC1698|NP_83 1.0000    188  
gi|225864482|BCA_2587|YP 1.0000    177  gi|218232261|BCB4264_A44 1.0000    375  
gi|30261223|BA1113|NP_84 1.0000    161  gi|255767354|BSU15320|NP 1.0000    239  
gi|47528082|GBAA2789|YP_ 1.0000    228  gi|212637937|Aflv_0088|Y 1.0000    223  
gi|218902228|BCAH820_111 1.0000    177  gi|30262705|BA2732|NP_84 1.0000    176  
gi|30261155|BA1032|NP_84 1.0000    177  gi|30019269|BC1114|NP_83 1.0000    161  
gi|30263387|BA3483|NP_84 1.0000    240  gi|56418624|GK0089|YP_14 1.0000    216  
gi|218233984|BCB4264_A53 1.0000    156  gi|212638144|Aflv_0295|Y 1.0000    159  
gi|118476646|BALH_0922|Y 1.0000    177  gi|49480428|BT9727_5044| 1.0000    176  
gi|217957742|BCAH187_A02 1.0000    164  gi|56418685|GK0150|YP_14 1.0000    187  
gi|42780899|BCE_1829|NP_ 1.0000    188  gi|227815066|BAMEG_2477| 1.0000    192  
gi|49479249|BT9727_3349| 1.0000    177  gi|47527044|GBAA1753|YP_ 1.0000    188  
gi|229603939|BAA_4584|YP 1.0000    237  

COMMAND LINE SUMMARY

This information can also be useful in the event you wish to report a
problem with the MEME software.

command: meme secondpass.twoline.faa -protein -mod zoops -nmotifs 10 -wg 3 -ws 1 -noendgaps -maxsize 200000 -dir /root 

model:  mod=         zoops    nmotifs=        10    evt=           inf
object function=  E-value of product of p-values
width:  minw=            8    maxw=           50    minic=        0.00
width:  wg=              3    ws=              1    endgaps=        no
nsites: minsites=        2    maxsites=      871    wnsites=       0.8
theta:  prob=            1    spmap=         pam    spfuzz=        120
em:     prior=       megap    b=          944665    maxiter=        50
        distance=    1e-05
data:   n=          188933    N=             871

sample: seed=            0    seqfrac=         1
Dirichlet mixture priors file: prior30.plib
Letter frequencies in dataset:
A 0.057 C 0.006 D 0.061 E 0.105 F 0.034 G 0.040 H 0.020 I 0.079 K 0.088 
L 0.103 M 0.028 N 0.036 P 0.022 Q 0.047 R 0.065 S 0.056 T 0.043 V 0.061 
W 0.009 Y 0.042 
Background letter frequencies (from dataset with add-one prior applied):
A 0.057 C 0.006 D 0.061 E 0.105 F 0.034 G 0.040 H 0.020 I 0.079 K 0.088 
L 0.103 M 0.028 N 0.036 P 0.022 Q 0.047 R 0.065 S 0.056 T 0.043 V 0.061 
W 0.009 Y 0.042 

P N
MOTIF 1     width = 15     sites = 707     llr = 14099     E-value = 5.0e-3215

SimplifiedA::11::1:::1::4:
pos.-specificC:::::::1:::::::
probabilityD29:::1:::::::::
matrixE61:::5:::::::::
F:::1:::4:::1:::
G::::::5::5:::::
H:::::::::::::1:
I::33:2::6::2::3
K:::::::::2::5::
L1:5::::11:62::2
M:::1:::11::1:::
N:::::::1:::::1:
P:::::::::::::::
Q::::8::::1:::::
R:::::::::1::1::
S::::1::::::::3:
T:::1::21:1:::::
V::13:12:1:1:::2
W:::::::::::1:::
Y:::::::11::3::1
bits 7.3
6.6
5.9
5.1
Information 4.4
content 3.7  
(28.8 bits)2.9  
2.2      
1.5             
0.7               
0.0
Multilevel EDLVQEGFIGLYKAI
consensus DIITKSL
sequence V
NAME   START P-VALUE    SITES 
gi|212637937|Aflv_0088|Y664.09e-16 RSYFLVGADREDIVQEGMIGLYKAIRDFKEDKQSS
gi|294496966|BMQ_0119|YP594.09e-16 RSYFLIGADREDIVQEGMIGLYKAIRDFREDKLTS
gi|295705913|BMD_3805|YP594.09e-16 RKYFLIGAEKEDIVQEGMIGLYKAIRDFNEDKLTS
gi|294500560|BMQ_3813|YP594.09e-16 RKYFLIGAEKEDIVQEGMIGLYKAIRDFNEDKLTS
gi|295696440|Btus_1834|Y604.09e-16 QRFLGRGYEPEDLFQIGCIGLMKAIDKFDLSYDVK
gi|15612678|BH0115|NP_24604.09e-16 RSYFLIGADHEDIVQEGMIGLYKAIRDFKGDKLSS
gi|169830054|Bsph_4638|Y594.09e-16 RSYFLIGADKEDIVQEGMIGLYKAIRDFKGDKLAS
gi|261409537|GYMC10_5766594.09e-16 RSYFLIGADREDIVQEGMIGLYKAIRDFKGDKLSS
gi|295702333|BMD_0117|YP594.09e-16 RSYFLIGADREDIVQEGMIGLYKAIRDFREDKLTS
gi|56418624|GK0089|YP_14595.52e-16 RSYFLVGADREDIVQEGMIGLYKAVRDFKGDKLSS
gi|56961915|ABC0133|YP_1635.52e-16 RSYFLIGADHEDIVQEGMIGLYKAVRDFNVDKLSS
gi|288554708|BpOF4_08465585.52e-16 RSYFLIGADHEDIVQEGMIGLYKAVRDFKGDKLAS
gi|138893768|GTNG_0089|Y595.52e-16 RSYFLVGADREDIVQEGMIGLYKAVRDFKGDKLSS
gi|297528465|GC56T3_0089705.52e-16 RSYFLVGADREDIVQEGMIGLYKAVRDFKGDKLSS
gi|261417590|GYMC61_0090705.52e-16 RSYFLVGADREDIVQEGMIGLYKAVRDFKGDKLSS
gi|16077166|BSU00980|NP_617.36e-16 RSYFLIGADREDIVQEGMIGLYKSIRDFKEDKLTS
gi|295694818|Btus_0134|Y617.36e-16 RSYFLIGADREDIVQEGMIGLYKSIRDFRNDKLVS
gi|52078593|BL03273|YP_0667.36e-16 RSYFLIGADREDIVQEGMIGLYKSIRDFREDKLTS
gi|157690881|BPUM_0083|Y617.36e-16 RSYFLIGADREDIVQEGMIGLYKSIRDFREDKLTS
gi|154684616|RBAM_001230617.36e-16 RSYFLIGADREDIVQEGMIGLYKSIRDFREDKLTS
gi|52783954|BLi00116|YP_667.36e-16 RSYFLIGADREDIVQEGMIGLYKSIRDFREDKLTS
gi|212638845|Aflv_1004|Y569.66e-16 QRFLNRGYEPEDLFQIGCIGLMKSVDKFDLSYDVK
gi|23097558|OB0103|NP_69609.66e-16 RTYFLVGADKEDIIQEGMIGLYKAIRDYDVDKLSS
gi|239825676|GWCH70_0094591.27e-15 RSYFLVGADREDIIQEGMIGLYKAVRDFKGDKLSS
gi|172056123|Exig_0079|Y561.27e-15 RSYFLIGADREDIIQEGMIGLYKAVRDYRTDKLAS
gi|222093864|BCQ_0107|YP591.65e-15 RSYFLVGADREDIVQEGMIGLFKAIRDYKEDKLSS
gi|152973941|Bcer98_0088591.65e-15 RSYFLVGADREDIVQEGMIGLFKAIRDYKEDKLSS
gi|118475864|BALH_0093|Y591.65e-15 RSYFLVGADREDIVQEGMIGLFKAIRDYKEDKLSS
gi|47525348|GBAA0093|YP_591.65e-15 RSYFLVGADREDIVQEGMIGLFKAIRDYKEDKLSS
gi|217957669|BCAH187_A01591.65e-15 RSYFLVGADREDIVQEGMIGLFKAIRDYKEDKLSS
gi|218901296|BCAH820_010591.65e-15 RSYFLVGADREDIVQEGMIGLFKAIRDYKEDKLSS
gi|225862146|BCA_0122|YP591.65e-15 RSYFLVGADREDIVQEGMIGLFKAIRDYKEDKLSS
gi|42779174|BCE_0093|NP_591.65e-15 RSYFLVGADREDIVQEGMIGLFKAIRDYKEDKLSS
gi|30018364|BC0114|NP_82591.65e-15 RSYFLVGADREDIVQEGMIGLFKAIRDYKEDKLSS
gi|227812767|BAMEG_0109|591.65e-15 RSYFLVGADREDIVQEGMIGLFKAIRDYKEDKLSS
gi|52145123|BCZK0089|YP_591.65e-15 RSYFLVGADREDIVQEGMIGLFKAIRDYKEDKLSS
gi|218895229|BCG9842_B52591.65e-15 RSYFLVGADREDIVQEGMIGLFKAIRDYKEDKLSS
gi|30260284|BA0093|NP_84591.65e-15 RSYFLVGADREDIVQEGMIGLFKAIRDYKEDKLSS
gi|229601909|BAA_0109|YP591.65e-15 RSYFLVGADREDIVQEGMIGLFKAIRDYKEDKLSS
gi|163938101|BcerKBAB4_0591.65e-15 RSYFLVGADREDIVQEGMIGLFKAIRDYKGDKLSS
gi|218231038|BCB4264_A01591.65e-15 RSYFLVGADREDIVQEGMIGLFKAIRDYKEDKLSS
gi|49476711|BT9727_0090|591.65e-15 RSYFLVGADREDIVQEGMIGLFKAIRDYKEDKLSS
gi|49183127|BAS0093|YP_0591.65e-15 RSYFLVGADREDIVQEGMIGLFKAIRDYKEDKLSS
gi|169827020|Bsph_1444|Y641.65e-15 GRFAYRGEQADDLFQVGCIGLMKAIDHFDLKHNVR
gi|296500928|BMB171_C009591.65e-15 RSYFLVGADREDIVQEGMIGLFKAIRDYKEDKLSS
gi|295696452|Btus_1846|Y651.65e-15 QRFNNRGENVDDLFQVGCIGLMKAIDNFDLGQNVK
gi|261405674|GYMC10_1825661.65e-15 QRFNNRGEFVDDLFQVGCIGLMKAIDNFDLSQNVK
gi|301051831|BACI_c01200591.65e-15 RSYFLVGADREDIVQEGMIGLFKAIRDYKEDKLSS
gi|212639646|Aflv_1820|Y652.75e-15 QRFNNRGEYVDDLFQVGCIGLMKSIDNFDLSQNVK
gi|42782996|BCE_3948|NP_952.75e-15 QRFNNRGEYVDDLFQVGCIGLMKSIDNFDLGQNVK
gi|218233406|BCB4264_A40652.75e-15 QRFNNRGEYVDDLFQVGCIGLMKSIDNFDLGQNVK
gi|227813187|BAMEG_0585|652.75e-15 QRFNNRGEYVDDLFQVGCIGLMKSIDNFDLGQNVK
gi|163941643|BcerKBAB4_3982.75e-15 QRFNNRGEYVDDLFQVGCIGLMKSIDNFDLGQNVK
gi|152976264|Bcer98_2552652.75e-15 QRFNNRGEFVDDLFQVGCIGLMKSIDNFDLSQNVK
gi|56419663|GK1128|YP_14652.75e-15 QRFNNRGEFVDDLFQVGCIGLMKSIDNFDLNQNVK
gi|49478441|BT9727_3645|952.75e-15 QRFNNRGEYVDDLFQVGCIGLMKSIDNFDLGQNVK
gi|30263905|BA4042|NP_84652.75e-15 QRFNNRGEYVDDLFQVGCIGLMKSIDNFDLGQNVK
gi|217961324|BCAH187_A39652.75e-15 QRFNNRGEYVDDLFQVGCIGLMKSIDNFDLGQNVK
gi|229602177|BAA_4068|YP652.75e-15 QRFNNRGEYVDDLFQVGCIGLMKSIDNFDLGQNVK
gi|30021992|BC3903|NP_83652.75e-15 QRFNNRGEYVDDLFQVGCIGLMKSIDNFDLGQNVK
gi|218905033|BCAH820_391652.75e-15 QRFNNRGEYVDDLFQVGCIGLMKSIDNFDLGQNVK
gi|225865885|BCA_4007|YP652.75e-15 QRFNNRGEYVDDLFQVGCIGLMKSIDNFDLGQNVK
gi|47778237|GBAA4042|YP_652.75e-15 QRFNNRGEYVDDLFQVGCIGLMKSIDNFDLGQNVK
gi|222097349|BCQ_3689|YP952.75e-15 QRFNNRGEYVDDLFQVGCIGLMKSIDNFDLGQNVK
gi|49186753|BAS3754|YP_0952.75e-15 QRFNNRGEYVDDLFQVGCIGLMKSIDNFDLGQNVK
gi|16078597|BSU15330|NP_662.75e-15 QRFNNRGEYVDDLFQVGCIGLMKSIDNFDLSHNVK
gi|218899057|BCG9842_B12652.75e-15 QRFNNRGEYVDDLFQVGCIGLMKSIDNFDLGQNVK
gi|52141585|BCZK3662|YP_952.75e-15 QRFNNRGEYVDDLFQVGCIGLMKSIDNFDLGQNVK
gi|118479123|BALH_3533|Y952.75e-15 QRFNNRGEYVDDLFQVGCIGLMKSIDNFDLGQNVK
gi|297530705|GC56T3_2445652.75e-15 QRFNNRGEFVDDLFQVGCIGLMKSIDNFDLNQNVK
gi|301055394|BACI_c38590952.75e-15 QRFNNRGEYVDDLFQVGCIGLMKSIDNFDLGQNVK
gi|157692208|BPUM_1427|Y662.75e-15 QRFNNRGEYVDDLFQVGCIGLMKSIDNFDLSHNVR
gi|239826533|GWCH70_1031652.75e-15 QRFNNRGEFVDDLFQVGCIGLMKSIDNFDLNQNVK
gi|288553150|BpOF4_00620652.75e-15 QRFNNRGEYVDDLFQVGCIGLMKSIDNFDLSQNVK
gi|295706362|BMD_4257|YP652.75e-15 QRFNNRGEFVDDLFQVGCIGLMKSIDNFDLSQNVK
gi|56964115|ABC2350|YP_1652.75e-15 QRFNNRGENVDDLFQVGCIGLMKSIDNFDLSQNVK
gi|138894663|GTNG_0993|Y702.75e-15 QRFNNRGEFVDDLFQVGCIGLMKSIDNFDLNQNVK
gi|23098931|OB1476|NP_69662.75e-15 QRFNNRGEYVDDLFQVGCIGLMKSIDNFDLSHNVR
gi|52785510|BLi01751|YP_662.75e-15 QRFNNRGEYVDDLFQVGCIGLMKSIDNFDLSHNVK
gi|154685949|RBAM_015160662.75e-15 QRFNNRGEYVDDLFQVGCIGLMKSIDNFDLSHNVK
gi|296504397|BMB171_C356652.75e-15 QRFNNRGEYVDDLFQVGCIGLMKSIDNFDLGQNVK
gi|294501013|BMQ_4269|YP652.75e-15 QRFNNRGEFVDDLFQVGCIGLMKSIDNFDLSQNVK
gi|15615117|BH2554|NP_24652.75e-15 QRFNNRGEYVDDLFQVGCIGLMKSIDNFDLSQNVK
gi|261419325|GYMC61_1901652.75e-15 QRFNNRGEFVDDLFQVGCIGLMKSIDNFDLNQNVK
gi|52080136|BL02256|YP_0662.75e-15 QRFNNRGEYVDDLFQVGCIGLMKSIDNFDLSHNVK
gi|288555973|BpOF4_14835623.52e-15 QRFMNRGYEADDLFQIGCIGLIKSVDKFDLSYDVK
gi|15614101|BH1538|NP_24603.52e-15 QRFLNRGYEADDLFQIGCIGLIKSVDKFDLSYDVK
gi|56963560|ABC1795|YP_1603.52e-15 QRFLNRGYEADDLFQIGCIGLIKSVDKFDLSYDVK
gi|218905210|BCAH820_409607.20e-15 QRFLNRGYEPDDLFQIGCIGLLKSVDKFDLSFDVK
gi|217961566|BCAH187_A42607.20e-15 QRFLNRGYEPDDLFQIGCIGLLKSVDKFDLSFDVK
gi|52141420|BCZK3829|YP_607.20e-15 QRFLNRGYEPDDLFQIGCIGLLKSVDKFDLSFDVK
gi|42783188|BCE_4142|NP_607.20e-15 QRFLNRGYEPDDLFQIGCIGLLKSVDKFDLSFDVK
gi|47529588|GBAA4294|YP_607.20e-15 QRFLNRGYEPDDLFQIGCIGLLKSVDKFDLSFDVK
gi|227816852|BAMEG_4334|607.20e-15 QRFLNRGYEPDDLFQIGCIGLLKSVDKFDLSFDVK
gi|118479276|BALH_3690|Y607.20e-15 QRFLNRGYEPDDLFQIGCIGLLKSVDKFDLSFDVK
gi|225866059|BCA_4185|YP607.20e-15 QRFLNRGYEPDDLFQIGCIGLLKSVDKFDLSFDVK
gi|16079402|BSU23450|NP_607.20e-15 QRFLNRGYEPDDLFQIGCIGLLKSVDKFDLTYDVR
gi|218899234|BCG9842_B10607.20e-15 QRFLNRGYEPDDLFQIGCIGLLKSVDKFDLSFDVK
gi|30264150|BA4294|NP_84607.20e-15 QRFLNRGYEPDDLFQIGCIGLLKSVDKFDLSFDVK
gi|49478518|BT9727_3813|607.20e-15 QRFLNRGYEPDDLFQIGCIGLLKSVDKFDLSFDVK
gi|218234550|BCB4264_A41607.20e-15 QRFLNRGYEPDDLFQIGCIGLLKSVDKFDLSFDVK
gi|222097523|BCQ_3863|YP607.20e-15 QRFLNRGYEPDDLFQIGCIGLLKSVDKFDLSFDVK
gi|49186981|BAS3983|YP_0607.20e-15 QRFLNRGYEPDDLFQIGCIGLLKSVDKFDLSFDVK
gi|30022159|BC4072|NP_83607.20e-15 QRFLNRGYEPDDLFQIGCIGLLKSVDKFDLSFDVK
gi|163941815|BcerKBAB4_3607.20e-15 QRFLNRGYEPDDLFQIGCIGLLKSVDKFDLSFDVK
gi|152976482|Bcer98_2771607.20e-15 QRFLNRGYEPDDLFQIGCIGLLKSVDKFDLSFDVK
gi|229603990|BAA_4316|YP607.20e-15 QRFLNRGYEPDDLFQIGCIGLLKSVDKFDLSFDVK
gi|56420843|GK2308|YP_14587.20e-15 QRFLNRGYEADDLFQIGCIGLLKSVDKFDLSYDVK
gi|157692844|BPUM_2076|Y607.20e-15 QRFLNRGYEPDDLFQIGCIGLLKSVDKFDLSYDVK
gi|52080862|BL00778|YP_0607.20e-15 QRFLNRGYEPDDLFQIGCIGLLKSVDKFDLSYDVR
gi|301055569|BACI_c40400607.20e-15 QRFLNRGYEPDDLFQIGCIGLLKSVDKFDLSFDVK
gi|296504567|BMB171_C373607.20e-15 QRFLNRGYEPDDLFQIGCIGLLKSVDKFDLSFDVK
gi|294501135|BMQ_4391|YP607.20e-15 QRFINRGYEPDDLFQIGCIGLLKSVDKFDLSYDVK
gi|295706482|BMD_4377|YP607.20e-15 QRFINRGYEPDDLFQIGCIGLLKSVDKFDLSYDVK
gi|52786234|BLi02495|YP_607.20e-15 QRFLNRGYEPDDLFQIGCIGLLKSVDKFDLSYDVR
gi|297529524|GC56T3_1195607.20e-15 QRFLNRGYEADDLFQIGCIGLLKSVDKFDLSYDVK
gi|239827600|GWCH70_2250587.20e-15 QRFLNRGYEPDDLFQIGCIGLLKSVDKFDLSYDVK
gi|138895880|GTNG_2239|Y607.20e-15 QRFLNRGYEADDLFQIGCIGLLKSVDKFDLSYDVK
gi|261417856|GYMC61_0374607.20e-15 QRFLNRGYEADDLFQIGCIGLLKSVDKFDLSYDVK
gi|261405990|GYMC10_2143597.20e-15 QRFMNRGYEPDDLFQIGCIGLLKSVDKFDLSYDVK
gi|154686587|RBAM_021560607.20e-15 QRFLNRGYEPDDLFQIGCIGLLKSVDKFDLSYDVR
gi|229917375|EAT1b_1650|561.09e-13 RSYFLIGADHEDIVQEGMIGLYKGVRDYKDERLAS
gi|297582430|Bsel_0095|Y552.30e-13 RSYFLIGADHEDILQEGMIGLYKAIRDFKQGKESS
gi|23098085|OB0630|NP_69586.54e-13 RKYSKNSAIHEDLVQVGMIGLLAAVRRYDPTYGKS
gi|295696453|Btus_1847|Y887.73e-13 RKFENTGIYIEDLVSIGTIGLIKAVNTFDPQKRIK
gi|288555708|BpOF4_13500347.73e-13 AAFTYDQNEVEDLTQEVFIRLFKSLSSFRGESELK
gi|229603939|BAA_4584|YP761.07e-12 KKFENTGEDAEDLISIGTIGLIKAIESYSAGKGTK
gi|49481469|BT9727_4074|761.07e-12 KKFENTGEDAEDLISIGTIGLIKAIESYSAGKGTK
gi|49187232|BAS4236|YP_0761.07e-12 KKFENTGEDAEDLISIGTIGLIKAIESYSAGKGTK
gi|222097784|BCQ_4125|YP1021.07e-12 KKFENTGEDAEDLISIGTIGLIKAIESYSAGKGTK
gi|56421070|GK2535|YP_14771.07e-12 KKFENTGEEVEDLISIGTIGLIKAIESYSPGKGTK
gi|218905533|BCAH820_441761.07e-12 KKFENTGEDAEDLISIGTIGLIKAIESYSAGKGTK
gi|227817116|BAMEG_4602|761.07e-12 KKFENTGEDAEDLISIGTIGLIKAIESYSAGKGTK
gi|217961829|BCAH187_A44761.07e-12 KKFENTGEDAEDLISIGTIGLIKAIESYSAGKGTK
gi|225866320|BCA_4450|YP761.07e-12 KKFENTGEDAEDLISIGTIGLIKAIESYSAGKGTK
gi|163942095|BcerKBAB4_4761.07e-12 KKFENTGEDAEDLISIGTIGLIKAIESYSAGKGTK
gi|218231149|BCB4264_A44761.07e-12 KKFENTGEDAEDLISIGTIGLIKAIESYSAGKGTK
gi|218899507|BCG9842_B07761.07e-12 KKFENTGEDAEDLISIGTIGLIKAIESYSAGKGTK
gi|118479504|BALH_3926|Y1101.07e-12 KKFENTGEDAEDLISIGTIGLIKAIESYSAGKGTK
gi|30022417|BC4336|NP_83791.07e-12 KKFENTGEDAEDLISIGTIGLIKAIESYSAGKGTK
gi|152976769|Bcer98_3065761.07e-12 KKFENTGEDAEDLISIGTIGLIKAIESYSAGKGTK
gi|30264411|BA4566|NP_84761.07e-12 KKFENTGEDAEDLISIGTIGLIKAIESYSAGKGTK
gi|42783467|BCE_4421|NP_1041.07e-12 KKFENTGEDAEDLISIGTIGLIKAIESYSAGKGTK
gi|52141167|BCZK4084|YP_761.07e-12 KKFENTGEDAEDLISIGTIGLIKAIESYSAGKGTK
gi|47529862|GBAA4566|YP_761.07e-12 KKFENTGEDAEDLISIGTIGLIKAIESYSAGKGTK
gi|138896107|GTNG_2470|Y771.07e-12 KKFENTGEEVEDLISIGTIGLIKAIESYSPNKGTK
gi|301055830|BACI_c43070201.07e-12 KKFENTGEDAEDLISIGTIGLIKAIESYSAGKGTK
gi|261418447|GYMC61_0982851.07e-12 KKFENTGEEVEDLISIGTIGLIKAIESYSPGKGTK
gi|294501329|BMQ_4591|YP771.07e-12 KKFENTGEDAEDLISIGTIGLIKAIESYSQGKGTK
gi|56963382|ABC1617|YP_1771.07e-12 KKFENTREDVEDLISIGTIGLIKAIESYSEGKGTK
gi|239827809|GWCH70_2471771.07e-12 KKFENTGEDAEDLISIGTIGLIKAIESYSPGKGTK
gi|157693076|BPUM_2309|Y1251.07e-12 KKFENTGEDAEDLISIGTIGLIKAIESYSSGKGTK
gi|295706676|BMD_4577|YP771.07e-12 KKFENTGEDAEDLISIGTIGLIKAIESYSQGKGTK
gi|52081127|BL02107|YP_0771.07e-12 KKFENTGEDAEDLISIGTIGLIKAIESYSAGKGTK
gi|261405539|GYMC10_1690771.07e-12 KKFDNTGEDLEDLISIGTIGLIKAIESFRPNKGTK
gi|295695806|Btus_1170|Y771.07e-12 KKFENTGEDTEDLISIGTIGLIKAIESFQPHKGTK
gi|296504831|BMB171_C400351.07e-12 KKFENTGEDAEDLISIGTIGLIKAIESYSAGKGTK
gi|297582861|Bsel_0539|Y641.07e-12 RKFSRGQRHDEDLVQVGMIGLLAALRRFDPSFGRS
gi|15613848|BH1285|NP_24771.07e-12 KKFENTREHTEDLISIGTIGLIKAIESFSEGKGTK
gi|297529299|GC56T3_0955851.07e-12 KKFENTGEEVEDLISIGTIGLIKAIESYSPGKGTK
gi|212638647|Aflv_0804|Y771.07e-12 KKFENTGEDPEDLISIGTIGLIKAIESYSTGKGTK
gi|52786504|BLi02769|YP_771.07e-12 KKFENTGEDAEDLISIGTIGLIKAIESYSAGKGTK
gi|288555607|BpOF4_12995771.07e-12 KKFENTREDTEDLISIGTIGLIKAIESYSDGKGTK
gi|255767354|BSU15320|NP851.26e-12 RKFENTGINIEDLISIGTIGLIKAVNTFNPEKKIK
gi|227813186|BAMEG_0584|851.26e-12 RKFENTGINIEDLISIGTIGLIKAVNTFNPEKKIK
gi|152976265|Bcer98_2553851.26e-12 RKFENTGINIEDLISIGTIGLIKAVNTFNPEKKIK
gi|218899058|BCG9842_B12851.26e-12 RKFENTGINIEDLISIGTIGLIKAVNTFNPEKKIK
gi|218905035|BCAH820_391851.26e-12 RKFENTGINIEDLISIGTIGLIKAVNTFNPEKKIK
gi|30263906|BA4043|NP_84851.26e-12 RKFENTGINIEDLISIGTIGLIKAVNTFNPEKKIK
gi|225865886|BCA_4008|YP851.26e-12 RKFENTGINIEDLISIGTIGLIKAVNTFNPEKKIK
gi|47529336|GBAA4043|YP_851.26e-12 RKFENTGINIEDLISIGTIGLIKAVNTFNPEKKIK
gi|212639647|Aflv_1821|Y851.26e-12 RKFENTGINIEDLISIGTIGLIKAVNTFNPEKKIK
gi|52141583|BCZK3663|YP_851.26e-12 RKFENTGINIEDLISIGTIGLIKAVNTFNPEKKIK
gi|42782997|BCE_3949|NP_851.26e-12 RKFENTGINIEDLISIGTIGLIKAVNTFNPEKKIK
gi|217961326|BCAH187_A39851.26e-12 RKFENTGINIEDLISIGTIGLIKAVNTFNPEKKIK
gi|222097350|BCQ_3690|YP851.26e-12 RKFENTGINIEDLISIGTIGLIKAVNTFNPEKKIK
gi|229601447|BAA_4069|YP851.26e-12 RKFENTGINIEDLISIGTIGLIKAVNTFNPEKKIK
gi|30021993|BC3904|NP_83851.26e-12 RKFENTGINIEDLISIGTIGLIKAVNTFNPEKKIK
gi|162382776|BALH_3534|Y851.26e-12 RKFENTGINIEDLISIGTIGLIKAVNTFNPEKKIK
gi|218234749|BCB4264_A40851.26e-12 RKFENTGINIEDLISIGTIGLIKAVNTFNPEKKIK
gi|49186754|BAS3755|YP_0851.26e-12 RKFENTGINIEDLISIGTIGLIKAVNTFNPEKKIK
gi|163941644|BcerKBAB4_3851.26e-12 RKFENTGINIEDLISIGTIGLIKAVNTFNPEKKIK
gi|49478442|BT9727_3646|851.26e-12 RKFENTGINIEDLISIGTIGLIKAVNTFNPEKKIK
gi|56419662|GK1127|YP_14851.26e-12 RKFENTGIHIEDLISIGTIGLIKAVNTFNPEKKIK
gi|294501014|BMQ_4270|YP851.26e-12 RKFENTGINIEDLISIGTIGLIKAVNTFNPEKKIK
gi|157692207|BPUM_1426|Y851.26e-12 RKFENTGINIEDLISIGTIGLIKAVNTFNPEKKIK
gi|15615119|BH2556|NP_24831.26e-12 RKFENTGINIEDLISIGTIGLIKAVNTFNPEKKIK
gi|296504398|BMB171_C356851.26e-12 RKFENTGINIEDLISIGTIGLIKAVNTFNPEKKIK
gi|52785509|BLi01750|YP_851.26e-12 RKFENTGINIEDLISIGTIGLIKAVNTFNPEKKIK
gi|154685948|RBAM_015150851.26e-12 RKFENTGINIEDLISIGTIGLIKAVNTFNPEKKIK
gi|52080135|BL02255|YP_0851.26e-12 RKFENTGINIEDLISIGTIGLIKAVNTFNPEKKIK
gi|288553151|BpOF4_00625831.26e-12 RKFENTGINIEDLISIGTIGLIKAVNTFNPEKKIK
gi|138894662|GTNG_0992|Y851.26e-12 RKFENTGIHIEDLISIGTIGLIKAVNTFNPEKKIK
gi|23098930|OB1475|NP_69851.26e-12 RKFENTGINIEDLISIGTIGLIKAVNTFNPEKKIK
gi|239826532|GWCH70_1030851.26e-12 RKFENTGINIEDLISIGTIGLIKAVNTFNPEKKIK
gi|56964116|ABC2351|YP_1831.26e-12 RKFENTGINIEDLISIGTIGLIKAVNTFNPEKKIK
gi|297530706|GC56T3_2446851.26e-12 RKFENTGIHIEDLISIGTIGLIKAVNTFNPEKKIK
gi|295706363|BMD_4258|YP851.26e-12 RKFENTGINIEDLISIGTIGLIKAVNTFNPEKKIK
gi|261419324|GYMC61_1900851.26e-12 RKFENTGIHIEDLISIGTIGLIKAVNTFNPEKKIK
gi|301055395|BACI_c38600841.26e-12 RKFENTGINIEDLISIGTIGLIKAVNTFNPEKKIK
gi|229917800|EAT1b_2078|582.03e-12 RKFSRGRAIHDDLVQVGMIGLLAALRRFDPEFGRS
gi|172058807|Exig_2804|Y582.03e-12 RKFSRGRPIHDDLVQVGMIGLLAALRRFDKEFGRS
gi|227816484|BAMEG_3941|373.22e-12 YSILNNIQQAEDAVQETFITLYKNLEKLHNLNIQE
gi|229603531|BAA_0728|YP373.22e-12 YSILNNIQQAEDAVQETFITLYKNLEKLHNLNIQE
gi|42779792|BCE_0714|NP_373.22e-12 YSILNNIQQAEDAVQETFITLYKNLAKLYSLSTEE
gi|52144667|BCZK0557|YP_373.22e-12 YSILNNIQQAEDAVQETFITLYKNLEKLHSLATEE
gi|47525925|GBAA0646|YP_373.22e-12 YSILNNIQQAEDAVQETFITLYKNLEKLHNLNIQE
gi|255767573|BSU25200|NP1613.22e-12 KRYVGRGMLFLDLIQEGNMGLMKAVEKFDYRKGYK
gi|218895700|BCG9842_B46373.22e-12 YSILNNIQQAEDAVQETFITLYKNLEKLHSLSTEE
gi|218232155|BCB4264_A06373.22e-12 YSILNNIQQAEDAVQETFITLYKNLEKLHSLATQE
gi|30260800|BA0646|NP_84373.22e-12 YSILNNIQQAEDAVQETFITLYKNLEKLHNLNIQE
gi|30018830|BC0647|NP_83373.22e-12 YSILNNIQQAEDAVQETFITLYKNLEKLHSLSTEE
gi|49183638|BAS0613|YP_0373.22e-12 YSILNNIQQAEDAVQETFITLYKNLEKLHNLNIQE
gi|163938569|BcerKBAB4_0373.22e-12 YSILNNIQQAEDAVQETFITLYKNLKKLHSLNTEE
gi|118476332|BALH_0588|Y373.22e-12 YSILNNIQQAEDAVQETFITLYKNLEKLHNLNIQE
gi|222094400|BCQ_0714|YP373.22e-12 YSILNNIQQAEDAVQETFITLYKNLEKLHSLSTEE
gi|225862624|BCA_0684|YP373.22e-12 YSILNNIQQAEDAVQETFITLYKNLEKLHNLNIQE
gi|218901842|BCAH820_070373.22e-12 YSILNNIQQAEDAVQETFITLYKNLEKLHSLATQE
gi|157693020|BPUM_2253|Y1633.22e-12 KRYVGRGMLFLDLIQEGNMGLMKAVEKFDYRKGYK
gi|154686781|RBAM_0235101633.22e-12 KRYVGRGMLFLDLIQEGNMGLMKAVEKFDYRKGYK
gi|163119552|BL03682|YP_1633.22e-12 KRYVGRGMLFLDLIQEGNMGLMKAVEKFDYRKGYK
gi|52786447|BLi02712|YP_1633.22e-12 KRYVGRGMLFLDLIQEGNMGLMKAVEKFDYRKGYK
gi|218232261|BCB4264_A441653.74e-12 KRYVGRGMLFLDLIQEGNMGLIKAVEKFDYRKGFK
gi|52141207|BCZK4042|YP_1633.74e-12 KRYVGRGMLFLDLIQEGNMGLIKAVEKFDYRKGFK
gi|42783418|BCE_4372|NP_1653.74e-12 KRYVGRGMLFLDLIQEGNMGLIKAVEKFDYRKGFK
gi|30264362|BA4515|NP_841633.74e-12 KRYVGRGMLFLDLIQEGNMGLIKAVEKFDYRKGFK
gi|218899458|BCG9842_B081653.74e-12 KRYVGRGMLFLDLIQEGNMGLIKAVEKFDYRKGFK
gi|218905429|BCAH820_4311633.74e-12 KRYVGRGMLFLDLIQEGNMGLIKAVEKFDYRKGFK
gi|229601154|BAA_4536|YP1633.74e-12 KRYVGRGMLFLDLIQEGNMGLIKAVEKFDYRKGFK
gi|30022370|BC4289|NP_831653.74e-12 KRYVGRGMLFLDLIQEGNMGLIKAVEKFDYRKGFK
gi|152976724|Bcer98_30191633.74e-12 KRYVGRGMLFLDLIQEGNMGLIKAVEKFDYRKGFK
gi|163942050|BcerKBAB4_41653.74e-12 KRYVGRGMLFLDLIQEGNMGLIKAVEKFDYRKGFK
gi|56421017|GK2482|YP_141653.74e-12 KRYVGRGMLFLDLIQEGNMGLIKAVEKFDYRKGYK
gi|212638699|Aflv_0856|Y1623.74e-12 KRYVGRGMLFLDLIQEGNMGLIKAVEKFDYRKGYK
gi|118479464|BALH_3885|Y1633.74e-12 KRYVGRGMLFLDLIQEGNMGLIKAVEKFDYRKGFK
gi|217961783|BCAH187_A441653.74e-12 KRYVGRGMLFLDLIQEGNMGLIKAVEKFDYRKGFK
gi|47529811|GBAA4515|YP_1633.74e-12 KRYVGRGMLFLDLIQEGNMGLIKAVEKFDYRKGFK
gi|49187190|BAS4194|YP_01633.74e-12 KRYVGRGMLFLDLIQEGNMGLIKAVEKFDYRKGFK
gi|225866273|BCA_4403|YP1633.74e-12 KRYVGRGMLFLDLIQEGNMGLIKAVEKFDYRKGFK
gi|227817068|BAMEG_4554|1633.74e-12 KRYVGRGMLFLDLIQEGNMGLIKAVEKFDYRKGFK
gi|49481307|BT9727_4032|1633.74e-12 KRYVGRGMLFLDLIQEGNMGLIKAVEKFDYRKGFK
gi|297584635|Bsel_2346|Y1613.74e-12 KRYVGRGMLFLDLIQEGNMGLIKAVEKFDYNKGFK
gi|295706627|BMD_4528|YP1673.74e-12 KRYVGRGMLFLDLIQEGNMGLIKAVEKFDYRKGYK
gi|297529352|GC56T3_10081653.74e-12 KRYVGRGMLFLDLIQEGNMGLIKAVEKFDYRKGYK
gi|261417657|GYMC61_01571653.74e-12 KRYVGRGMLFLDLIQEGNMGLIKAVEKFDYRKGYK
gi|56963455|ABC1690|YP_11633.74e-12 KRYVGRGMLFLDLIQEGNMGLIKAVEKFDYDKGFK
gi|239827752|GWCH70_24141643.74e-12 KRYVGRGMLFLDLIQEGNMGLIKAVEKFDYRKGYK
gi|229916320|EAT1b_0589|1543.74e-12 KRYVGRGMLFLDLIQEGNMGLIKAVEKFDYMKGFK
gi|288555754|BpOF4_137301623.74e-12 KRYVGRGMLFLDLIQEGNMGLIKAVEKFDYEKGYK
gi|169829158|Bsph_3702|Y1653.74e-12 KRYVGRGMLFLDLIQEGNMGLIKAVEKFDYRKGFK
gi|301055785|BACI_c426201653.74e-12 KRYVGRGMLFLDLIQEGNMGLIKAVEKFDYRKGFK
gi|172056869|Exig_0832|Y1513.74e-12 KRYVGRGMLFLDLIQEGNMGLIKAVEKFDYTKGYK
gi|261407775|GYMC10_39811063.74e-12 RRYAGRGMQFLDLIQEGNMGLIKAVEKFDYSKGFK
gi|261405623|GYMC10_17741673.74e-12 KRYVGRGMLFLDLIQEGNMGLIKAVEKFDYKKGFK
gi|23099399|OB1944|NP_691703.74e-12 KRYVGRGMLFLDLIQEGNMGLIKAVEKFDYRKGFK
gi|294501280|BMQ_4542|YP1673.74e-12 KRYVGRGMLFLDLIQEGNMGLIKAVEKFDYRKGYK
gi|138896056|GTNG_2419|Y1653.74e-12 KRYVGRGMLFLDLIQEGNMGLIKAVEKFDYRKGYK
gi|15613939|BH1376|NP_241623.74e-12 KRYVGRGMLFLDLIQEGNMGLIKAVEKFDYNKGFK
gi|296504786|BMB171_C3951653.74e-12 KRYVGRGMLFLDLIQEGNMGLIKAVEKFDYRKGFK
gi|297582645|Bsel_0319|Y295.03e-12 LVYYTRRDDVEDLVQETFIRALRSIDGFEGRSAAK
gi|294500199|BMQ_3443|YP446.72e-12 YSYVNSVAVAEDLTQEIFIKCYKNLYRYSGKSKFR
gi|294497070|BMQ_0235|YP577.75e-12 RRYSKGRSLHEDIVQVGMLGLLGAIRRYDASFGRS
gi|295702435|BMD_0229|YP577.75e-12 RRYSKGRSLHEDIVQVGMLGLLGAIRRYDASFGRS
gi|295695448|Btus_0783|Y1698.93e-12 KRYVGRGMLFLDLIQEGNLGLIKAVEKFDFRKGFK
gi|218232670|BCB4264_A10571.18e-11 YRYSKGGPMHEDIIQVGMLGLLGAIRRYDYSIGNA
gi|218896055|BCG9842_B42571.18e-11 YRYSKGGPMHEDIIQVGMLGLLGAIRRYDYSIGNA
gi|225862940|BCA_1029|YP571.18e-11 YRYSKGGPMHEDIIQVGMLGLLGAIRRYDYSIGNA
gi|227816152|BAMEG_3579|571.18e-11 YRYSKGGPMHEDIIQVGMLGLLGAIRRYDYSIGNA
gi|229604478|BAA_1086|YP571.18e-11 YRYSKGGPMHEDIIQVGMLGLLGAIRRYDYSIGNA
gi|30261116|BA0992|NP_84571.18e-11 YRYSKGGPMHEDIIQVGMLGLLGAIRRYDYSIGNA
gi|47526271|GBAA0992|YP_571.18e-11 YRYSKGGPMHEDIIQVGMLGLLGAIRRYDYSIGNA
gi|118476614|BALH_0889|Y581.18e-11 YRYSKGGPMHEDIIQVGMLGLLGAIRRYDYSIGNA
gi|52144331|BCZK0896|YP_581.18e-11 YRYSKGGPMHEDIIQVGMLGLLGAIRRYDYSIGNA
gi|218902186|BCAH820_106571.18e-11 YRYSKGGPMHEDIIQVGMLGLLGAIRRYDYSIGNA
gi|30019159|BC1004|NP_83581.18e-11 YRYSKGGPMHEDIIQVGMLGLLGAIRRYDYSIGNA
gi|222094730|BCQ_1068|YP571.18e-11 YRYSKGGPMHEDIIQVGMLGLLGAIRRYDYSIGNA
gi|217958581|BCAH187_A11571.18e-11 YRYSKGGPMHEDIIQVGMLGLLGAIRRYDYSIGNA
gi|49480184|BT9727_0913|581.18e-11 YRYSKGGPMHEDIIQVGMLGLLGAIRRYDYSIGNA
gi|49183950|BAS0928|YP_0581.18e-11 YRYSKGGPMHEDIIQVGMLGLLGAIRRYDYSIGNA
gi|42780162|BCE_1086|NP_571.18e-11 YRYSKGGPMHEDIIQVGMLGLLGAIRRYDYSIGNA
gi|163938900|BcerKBAB4_0571.18e-11 YRYSKGGPMHEDIIQVGMLGLLGAIRRYDYSIGNA
gi|301052635|BACI_c10250581.18e-11 YRYSKGGPMHEDIIQVGMLGLLGAIRRYDYSIGNA
gi|296501716|BMB171_C087571.18e-11 YRYSKGGPMHEDIIQVGMLGLLGAIRRYDYSIGNA
gi|152976319|Bcer98_2607471.35e-11 AIKDDTGLEFEDLVQCGMIALIKAREQFKPEMGFK
gi|169829726|Bsph_4295|Y571.35e-11 RKYSNGKSYYDDIVQVGMLGLLGAIRRFDPNVGRS
gi|52784380|BLi00560|YP_581.55e-11 KKYSKGKSFHEDLCQVGMLGLLGAIKRYDPDVGKS
gi|52079008|BL02208|YP_0571.55e-11 KKYSKGKSFHEDLCQVGMLGLLGAIKRYDPDVGKS
gi|23099294|OB1839|NP_69581.55e-11 QRFINRGYDPDDLFQIGSIGLIKSIDKFDLSYDVK
gi|169829306|Bsph_3856|Y702.32e-11 KKFHPKHEQLDDYISIGTIGLMKAVESYTPDKKTR
gi|163940286|BcerKBAB4_2402.65e-11 FIITKDPHLSDDITQDVFIKVFKHWNSFRKESSIK
gi|255767137|BSU04730|NP573.01e-11 KKYSKGKSFHEDLRQVGMIGLLGAIKRYDPVVGKS
gi|154686834|RBAM_024040773.01e-11 KKFENTGEDAEDLISIGTIGLIKGIESYSAGKGTK
gi|154684976|RBAM_005070573.01e-11 KKYSKGKSFHEDLRQVGMIGLLGAIKRYDPEVGKS
gi|157691239|BPUM_0446|Y573.01e-11 KKYSKGKSFHEDLRQVGMIGLLGAIKRYDPLVGKS
gi|42780207|BCE_1131|NP_443.43e-11 YSYVNNKEVAEDLTQDIFVKCYKSLHTYKGNSNVK
gi|217958624|BCAH187_A12443.43e-11 YSYVNNKEVAEDLTQDIFVKCYKSLHTYKGNSNLK
gi|222094769|BCQ_1107|YP233.43e-11 YSYVNNKEVAEDLTQDIFVKCYKSLHTYKGNSNLK
gi|163938949|BcerKBAB4_0443.43e-11 YSYVNNKEVAEDLTQDIFVKCYKSLHTYKGKSNVK
gi|52144286|BCZK0942|YP_443.43e-11 YSYVNNKEVAEDLTQDIFVKCYKSLHTYKGNSNLK
gi|23099454|OB1999|NP_69773.43e-11 KKFENTGEDMEDLISIGTIGLIKGVESFSTDKGTK
gi|225864482|BCA_2587|YP403.90e-11 FIITKDPHLSDDITQDVFIKVFKNWNSFRKESSIK
gi|118477905|BALH_2250|Y433.90e-11 FIITKDPHLSDDITQDVFIKVFKNWNSFRKESSIK
gi|42781595|BCE_2534|NP_403.90e-11 FIITKDPHLSDDITQDVFIKVFKNWNSFRKESSIK
gi|217959986|BCAH187_A25403.90e-11 FIITKDPHLSDDITQDVFIKVFKNWNSFRKESSIK
gi|218903633|BCAH820_251403.90e-11 FIITKDPHLSDDITQDVFIKVFKNWNSFRRESSIK
gi|52142997|BCZK2243|YP_423.90e-11 FIITKDPHLSDDITQDVFIKVFKNWNSFRKESSIK
gi|218231851|BCB4264_A24403.90e-11 FIITKDPHLSDDITQDVFIKVFKNWNSFRKESSIK
gi|30020599|BC2469|NP_83423.90e-11 FIITKDPHLSDDITQDVFIKVFKNWNSFRKESSIK
gi|222096073|BCQ_2413|YP403.90e-11 FIITKDPHLSDDITQDVFIKVFKNWNSFRKESSIK
gi|49479242|BT9727_2287|423.90e-11 FIITKDPHLSDDITQDVFIKVFKNWNSFRKESSIK
gi|218897485|BCG9842_B28403.90e-11 FIITKDPHLSDDITQDVFIKVFKNWNSFRKESSIK
gi|52787786|BLi04109|YP_473.90e-11 LKLTLNPDLTEDLVQETMLKAYVSLHQFQGNAKFS
gi|301054038|BACI_c24720403.90e-11 FIITKDPHLSDDITQDVFIKVFKNWNSFRKESSIK
gi|261409476|GYMC10_5703463.90e-11 YRMLSNRHEAEDVVQETFLRVYKNLDRYDENQKFS
gi|296503062|BMB171_C223403.90e-11 FIITKDPHLSDDITQDVFIKVFKNWNSFRKESSIK
gi|52082396|BL00940|YP_0473.90e-11 LKLTLNPDLTEDLVQETMLKAYVSLHQFQGNAKFS
gi|261405673|GYMC10_1824865.02e-11 RKFENTGINIEDLVSIGAIGLIKAVNTFDPEKKIK
gi|288554854|BpOF4_09205575.02e-11 RKFSKGREYDEDLYQVGMVGLLAALTRFDSEFGRS
gi|49476853|BT9727_0558|378.21e-11 YSILNNIQQAEDTVQETFITLYKNLEKLHNLNIQE
gi|169827019|Bsph_1443|Y498.21e-11 RRFDNTGTPIEDLISIGSIGLIKAIETFNTDKNIK
gi|118476646|BALH_0922|Y441.32e-10 YSYVNNKEVAEDVTQDIFVKCYKSLHTYKGNSNLK
gi|30261155|BA1032|NP_84441.32e-10 YSYVNNKEVAEDVTQDIFVKCYKSLHTYKGNSNLK
gi|218902228|BCAH820_111441.32e-10 YSYVNNKEVAEDVTQDIFVKCYKSLHTYKGNSNLK
gi|225862980|BCA_1069|YP441.32e-10 YSYVNNKEVAEDVTQDIFVKCYKSLHTYKGNSNLK
gi|49477062|BT9727_0953|441.32e-10 YSYVNNKEVAEDVTQDIFVKCYKSLHTYKGNSNLK
gi|227816114|BAMEG_3540|441.32e-10 YSYVNNKEVAEDVTQDIFVKCYKSLHTYKGNSNLK
gi|47777889|GBAA1032|YP_441.32e-10 YSYVNNKEVAEDVTQDIFVKCYKSLHTYKGNSNLK
gi|218231966|BCB4264_A10441.32e-10 YSYVNNKEVAEDVTQDIFVKCYKSLHTYKGKSNVK
gi|218896095|BCG9842_B42441.32e-10 YSYVNNKEIAEDVTQDIFVKCYKSLHTYKGKSNVK
gi|229604778|BAA_1124|YP441.32e-10 YSYVNNKEVAEDVTQDIFVKCYKSLHTYKGNSNLK
gi|49183986|BAS0964|YP_0731.32e-10 YSYVNNKEVAEDVTQDIFVKCYKSLHTYKGNSNLK
gi|301052678|BACI_c10700441.32e-10 YSYVNNKEVAEDVTQDIFVKCYKSLHTYKGNSNLK
gi|296501752|BMB171_C091731.32e-10 YSYVNNKEVAEDVTQDIFVKCYKSLHTYKGKSNVK
gi|212638144|Aflv_0295|Y331.49e-10 YVYMRNEHDAEDVFQDVFIKLYEHMGRIQSEEHMK
gi|56962590|ABC0816|YP_1571.49e-10 RKFSKGREYDEDLYQVGMVGLLAAMKRYNEDYGRS
gi|295696809|Btus_2226|Y471.49e-10 RRLTGNRDDALDLTQETFIRAFRHLDRFQPGRPFK
gi|16077241|BSU01730|NP_461.87e-10 YRMLGNVHEAEDIAQEAFIRAYVNIDSFDINRKFS
gi|52784027|BLi00199|YP_461.87e-10 YRMLGNAHEAEDIAQEAFIRAYVNIDSFDINRKFS
gi|154684695|RBAM_002260461.87e-10 YRMLGNVHEAEDIAQEAFIRAYVNIDSFDINRKFS
gi|157690957|BPUM_0160|Y541.87e-10 YRMLGNAHEAEDIAQEAFIRAYVNIESFDVNRKFS
gi|52078665|BL02699|YP_0461.87e-10 YRMLGNAHEAEDIAQEAFIRAYVNIDSFDINRKFS
gi|261409365|GYMC10_5592451.87e-10 TQRLADRQKAQDIVQETFIRLIRHLKQHGTLEHVR
gi|217958232|BCAH187_A07372.10e-10 YSILNNIQQAEDSVQETFITLYKNLEKLHSLSTEE
gi|52786190|BLi02449|YP_312.10e-10 FYMVKDKNQAEDLVQEVYIRVLHSYETFEGRSSEK
gi|157692810|BPUM_2042|Y312.10e-10 FYMVKDKNQAEDLVQEVYIRVLHSYKTFEGRSSEK
gi|52080819|BL00651|YP_0312.10e-10 FYMVKDKNQAEDLVQEVYIRVLHSYETFEGRSSEK
gi|239827551|GWCH70_2200312.63e-10 FYMVRNREQAEDLVQEVYIKVLRSYKRFKGESSEK
gi|49480428|BT9727_5044|322.94e-10 YKLAKTKEDAEDIFQETWIKVFSSRHQLSYVENYK
gi|49188198|BAS5212|YP_0312.94e-10 YKLAKTKEDAEDIFQETWIKVFSSRHQLSYVENYK
gi|218906540|BCAH820_545312.94e-10 YKLAKTKEDAEDIFQETWIKVFSSRHQLSYVENYK
gi|222097738|BCQ_4079|YP1652.94e-10 KRYVGRGMLFLDLIQEGNMGLIKAGEKFDYRKGFK
gi|225867344|BCA_5512|YP312.94e-10 YKLAKTKEDAEDIFQETWIKVFSSRHQLSYVENYK
gi|227818128|BAMEG_5654|312.94e-10 YKLAKTKEDAEDIFQETWIKVFSSRHQLSYVENYK
gi|217962852|BCAH187_A55312.94e-10 YKLAKTKEDAEDIFQETWIKVFSSRHQLSYVENYK
gi|42784537|BCE_5492|NP_312.94e-10 YKLAKTKEDAEDIFQETWIKVFSSRHQLSYVENHK
gi|218900489|BCG9842_B54312.94e-10 YKLAKTKEDAEDIFQETWIKVFSSRHQLSYVDNYK
gi|118480394|BALH_4859|Y632.94e-10 YKLAKTKEDAEDIFQETWIKVFSSRHQLSYVENYK
gi|52140200|BCZK5060|YP_312.94e-10 YKLAKTKEDAEDIFQETWIKVFSSRHQLSYVENYK
gi|30023393|BC5363|NP_83322.94e-10 YKLAKTKEDAEDIFQETWIKVFSSRHQLSYVENYK
gi|30265385|BA5610|NP_84312.94e-10 YKLAKTKEDAEDIFQETWIKVFSSRHQLSYVENYK
gi|229601723|BAA_5636|YP312.94e-10 YKLAKTKEDAEDIFQETWIKVFSSRHQLSYVENYK
gi|222098834|BCQ_5203|YP312.94e-10 YKLAKTKEDAEDIFQETWIKVFSSRHQLSYVENYK
gi|47530932|GBAA5610|YP_312.94e-10 YKLAKTKEDAEDIFQETWIKVFSSRHQLSYVENYK
gi|301056831|BACI_c53580312.94e-10 YKLAKTKEDAEDIFQETWIKVFSSRHQLSYVENYK
gi|296505785|BMB171_C495312.94e-10 YKLAKTKEDAEDIFQETWIKVFSSRHQLSYVENYK
gi|261406063|GYMC10_2217473.29e-10 LKSSHMELMAEDLCSETFYKAFRSLHSFREVDASF
gi|30019269|BC1114|NP_83333.67e-10 LSLTGDSHYAEDLMQETFYRMLVHIDYYKGEEIRP
gi|30261223|BA1113|NP_84333.67e-10 LSLTGDSHFAEDLMQETFYRMLVHIDYYKGEEIRP
gi|49184055|BAS1035|YP_0333.67e-10 LSLTGDSHFAEDLMQETFYRMLVHIDYYKGEEIRP
gi|218896153|BCG9842_B41333.67e-10 LSLTGDSPYAEDLMQETFYRMLVHIDYYKGEEIRP
gi|47526385|GBAA1113|YP_333.67e-10 LSLTGDSHFAEDLMQETFYRMLVHIDYYKGEEIRP
gi|218902311|BCAH820_119333.67e-10 LSLTGDSHFAEDLMQETFYRMLVHIDYYKGEEIRP
gi|229602397|BAA_1198|YP333.67e-10 LSLTGDSHFAEDLMQETFYRMLVHIDYYKGEEIRP
gi|225863070|BCA_1159|YP333.67e-10 LSLTGDSHFAEDLMQETFYRMLVHIDYYKGEEIRP
gi|163939015|BcerKBAB4_1333.67e-10 LSLTGDSHSAEDLMQETFYRMLVHIDYYKGEEIRP
gi|227816040|BAMEG_3466|333.67e-10 LSLTGDSHFAEDLMQETFYRMLVHIDYYKGEEIRP
gi|222094839|BCQ_1177|YP333.67e-10 LSLTGDSHFAEDLMQETFYRMLVHIDYYKGEEIRP
gi|218232533|BCB4264_A11333.67e-10 LSLTGDSHYAEDLMQETFYRMLVHIDYYKGEEIRP
gi|217958692|BCAH187_A12333.67e-10 LSLTGDSHFAEDLMQETFYRMLVHIDYYKGEEIRP
gi|42780290|BCE_1215|NP_333.67e-10 LSLTGDSHFAEDLMQETFYRMLVHIDYYKGEEIRP
gi|52144214|BCZK1013|YP_333.67e-10 LSLTGDCHYAEDLMQETFYRMLVHIDYYKGEEIRP
gi|49477092|BT9727_1012|333.67e-10 LSLTGDSHFAEDLMQETFYRMLVHIDYYKGEEIRP
gi|138893826|GTNG_0147|Y213.67e-10 YRMLGNRHEAEDAAQEAFIRAYVHIDTYNPNMKFS
gi|301052754|BACI_c11460333.67e-10 LSLTGDSHFAEDLMQETFYRMLVHIDYYKGEEIRP
gi|15613092|BH0529|NP_24573.67e-10 RKFSRSRAHDDDLIQVGMVGLLAAFERYDPKYGRS
gi|261404455|GYMC10_0586323.67e-10 YSLSYDHHTAEDLVQETFYRAYLYLEDWKEERIKP
gi|261408152|GYMC10_4361383.67e-10 LSLTNSSWDSDDLVQDTWIKALEHLQQRSHANPEA
gi|169827149|Bsph_1579|Y693.67e-10 SAGLPKSVSRDDLTSLGMIGLFDALNKFDINRDLK
gi|227815066|BAMEG_2477|484.09e-10 HFLIEDKTDVDDVVQEVYIQLYESLRKYDSEKPFR
gi|49184977|BAS1966|YP_0484.09e-10 HFLIEDKTDVDDVVQEVYIQLYESLRKYDSEKPFR
gi|229602619|BAA_2180|YP484.09e-10 HFLIEDKTDVDDVVQEVYIQLYESLRKYDSEKPFR
gi|30262135|BA2114|NP_84484.09e-10 HFLIEDKTDVDDVVQEVYIQLYESLRKYDSEKPFR
gi|30020245|BC2108|NP_83484.09e-10 HFLIEDKTDVDDVVQEVYIQLYESLRKYDSEKPFR
gi|47527408|GBAA2114|YP_484.09e-10 HFLIEDKTDVDDVVQEVYIQLYESLRKYDSEKPFR
gi|218232753|BCB4264_A21484.09e-10 HFLIEDKTDVDDVVQEVYIQLYESLRKYDSEKPFR
gi|296502728|BMB171_C189484.09e-10 HFLIEDKTDVDDVVQEVYIQLYESLRKYDSGKPFR
gi|157692327|BPUM_1546|Y534.56e-10 SIGLPKSVHKEDLISLGMLGLYDALEKFDPGRDLK
gi|261406105|GYMC10_2260234.56e-10 YSVLRDAKEAEDASQEVFIQVYKALPQYRSEGFKT
gi|295695216|Btus_0545|Y354.56e-10 RSLIAAPDAVEDLAQEVFVRLYRHPPDDPSKVAPW
gi|212637996|Aflv_0147|Y465.07e-10 YRMLGNRHEAEDAAQEAFIRAYVNIHTYDPTMKFS
gi|239825735|GWCH70_0154425.07e-10 YRMLGNRHEAEDAAQEAFIRAYVNIHTYNPNMRFS
gi|52785627|BLi01868|YP_535.07e-10 AVGLPKSVHKDDLVSLGMLGLYDALEKFDPGRDLK
gi|52080250|BL01246|YP_0535.07e-10 AVGLPKSVHKDDLVSLGMLGLYDALEKFDPGRDLK
gi|261406462|GYMC10_2625575.65e-10 YYILKNHAETEDAVQEIFIRAYEHLHLYKRQVSFS
gi|23097683|OB0228|NP_69465.65e-10 YRMLGNKHEAEDIAQEAFIRAYINIDSFDEKRKFS
gi|218233984|BCB4264_A53316.28e-10 IKKLGIRKDYEEYYQCGLIGLWHAYERFDEKKGYF
gi|225867222|BCA_5390|YP316.28e-10 IKKLGIYQDYEEYYQCGLIGLWHAYERYDAKKGSF
gi|30023283|BC5251|NP_83316.28e-10 IKKLGIRKDYEEYYQCGLIGLWHAYERFDEKKGYF
gi|227814691|BAMEG_2101|406.28e-10 FIITKDPHLSGDITQDVFIKVFKNWNSFRRESSIK
gi|227818013|BAMEG_5539|316.28e-10 IKKLGIYQDYEEYYQCGLIGLWHAYERYDAKKGSF
gi|30265276|BA5493|NP_84216.28e-10 IKKLGIYQDYEEYYQCGLIGLWHAYERYDAKKGSF
gi|47527789|GBAA2502|YP_406.28e-10 FIITKDPHLSGDITQDVFIKVFKNWNSFRRESSIK
gi|217962737|BCAH187_A54316.28e-10 IKKLGIYQDYEEYYQCGLIGLWHAYEKFDAEKGSF
gi|222098712|BCQ_5081|YP316.28e-10 IKKLGIYQDYEEYYQCGLIGLWHAYEKFDAEKGSF
gi|229603576|BAA_5520|YP316.28e-10 IKKLGIYQDYEEYYQCGLIGLWHAYERYDAKKGSF
gi|49481227|BT9727_4932|216.28e-10 IKKLGIYQDYEEYYQCGLIGLWHAYERYDAKKGSF
gi|163942935|BcerKBAB4_5316.28e-10 IKRLNIYQDYEEYYQCGLIGLWHAYERYEEEKGSF
gi|218900375|BCG9842_B55316.28e-10 IKKLGIRQDYEEYYQCGLIGLWHAYERFDAKKGYF
gi|49185332|BAS2323|YP_0426.28e-10 FIITKDPHLSGDITQDVFIKVFKNWNSFRRESSIK
gi|30262499|BA2502|NP_84406.28e-10 FIITKDPHLSGDITQDVFIKVFKNWNSFRRESSIK
gi|42784415|BCE_5370|NP_316.28e-10 IKRLGIYQDYEEYYQCGLIGLWHAYEKFDAEKGSF
gi|52140312|BCZK4947|YP_316.28e-10 IKKLGIYQDYEEYYQCGLIGLWHAYERYDAKKGSF
gi|47530811|GBAA5493|YP_216.28e-10 IKKLGIYQDYEEYYQCGLIGLWHAYERYDAKKGSF
gi|49188088|BAS5102|YP_0216.28e-10 IKKLGIYQDYEEYYQCGLIGLWHAYERYDAKKGSF
gi|229604897|BAA_2557|YP406.28e-10 FIITKDPHLSGDITQDVFIKVFKNWNSFRRESSIK
gi|295704249|BMD_2121|YP336.28e-10 LSLTRRKESAEDLMQETFYRALLHLETYKGEEVKP
gi|296505675|BMB171_C484316.28e-10 IKKLGIRKDYEEYYQCGLIGLWHAYERFDAKKGYF
gi|294498927|BMQ_2164|YP336.28e-10 LSLTRRKESAEDLMQETFYRALLHLETYKGEEVKP
gi|301056717|BACI_c52440316.28e-10 IKKLGIYQDYEEYYQCGLIGLWHAYERYDAKKGSF
gi|15613235|BH0672|NP_24306.28e-10 YRLLGSVTDAEDLVQETFLRAYQAEEREINNKKAY
gi|288556053|BpOF4_15235436.97e-10 FQLGAKESSVEDITQEVFIKVYRFLSKHTRGKFTT
gi|227814227|BAMEG_1635|487.74e-10 FLVGSQNQDVDDIVNEVYIKMWKSVTNYDMNRSFR
gi|49185764|BAS2758|YP_0487.74e-10 FLVGSQNQDVDDIVNEVYIKMWKSVTNYDMNRSFR
gi|218904082|BCAH820_296487.74e-10 FLVGSQNQDVDDIVNEVYIKMWKSVTNYDMNRSFR
gi|161486563|BA2970|NP_8487.74e-10 FLVGSQNQDVDDIVNEVYIKMWKSVTNYDMNRSFR
gi|229602282|BAA_3022|YP487.74e-10 FLVGSQNQDVDDIVNEVYIKMWKSVTNYDMNRSFR
gi|161611198|GBAA2970|YP487.74e-10 FLVGSQNQDVDDIVNEVYIKMWKSVTNYDMNRSFR
gi|15615924|BH3362|NP_24477.74e-10 YSYVKDKQIAEDLTQEVFVRAFQSYHTYQTRSSAK
gi|49478105|BT9727_3026|298.58e-10 FSLSRSHHVAEDLMQETFYRAYLYLEDYENQKVKS
gi|218904418|BCAH820_330298.58e-10 FSLSRSHHVAEDLMQETFYRAYLYLEDYENQKVKS
gi|52142270|BCZK2972|YP_298.58e-10 FSLSRSHHVAEDLMQETFYRAYLYLEDYENQKVKS
gi|47528609|GBAA3324|YP_298.58e-10 FSLSRSHHAAEDLMQETFYRAYLYLEDYENQKVKS
gi|225865247|BCA_3356|YP298.58e-10 FSLSRSHHAAEDLMQETFYRAYLYLEDYENQKVKS
gi|227813895|BAMEG_1301|298.58e-10 FSLSRSHHAAEDLMQETFYRAYLYLEDYENQKVKS
gi|229604117|BAA_3359|YP298.58e-10 FSLSRSHHAAEDLMQETFYRAYLYLEDYENQKVKS
gi|49186087|BAS3082|YP_0298.58e-10 FSLSRSHHAAEDLMQETFYRAYLYLEDYENQKVKS
gi|30263235|BA3324|NP_84298.58e-10 FSLSRSHHAAEDLMQETFYRAYLYLEDYENQKVKS
gi|163940993|BcerKBAB4_3298.58e-10 FSLSRSHHVAEDLMQETFYRAYLYLEDYENQKVKS
gi|301054766|BACI_c32210468.58e-10 FSLSRSHHVAEDLMQETFYRAYLYLEDYENQKVKS
gi|56420261|GK1726|YP_14239.51e-10 YRLTNDYHLAEDLLQETFYKVYLHVSGISDIAQIK
gi|23100547|OB3092|NP_69469.51e-10 YAISKNKNDASDIVQETFIRVFRNIDSYDINRPFR
gi|56964615|ABC2851|YP_1379.51e-10 WSIRSSWFHYSDLISVGTIGLINAVENYENKKGIT
gi|56418685|GK0150|YP_14461.05e-09 YRMLGNRHEAEDAAQEAFIRAYIHIDTYNPEMKFS
gi|16078017|BSU09520|NP_291.05e-09 LSMTKDKHLAEDLLQETFMRAYIHIHSYDHSKVKP
gi|288553039|BpOF4_00065541.05e-09 SVGLPKNVSKDDLTSHGMLGLYDALEKFNPNRDLK
gi|52784792|BLi01020|YP_291.05e-09 LSMTKDKHLAEDLLQETFMRAYIHIHSYDHSKVKP
gi|154686555|RBAM_021240311.05e-09 FYMVKDKSQAEDLTQEVYIRVLNSYHTFEGRSSEK
gi|261417650|GYMC61_0150491.05e-09 YRMLGNRHEAEDAAQEAFIRAYIHIDTYNPEMKFS
gi|52079432|BL02851|YP_0291.05e-09 LSMTKDKHLAEDLLQETFMRAYIHIHSYDHSKVKP
gi|157691684|BPUM_0902|Y291.05e-09 LSMTKDKHLAEDLLQETFMRAYIHIHSYDHSKVKP
gi|154685410|RBAM_009760291.05e-09 LSMTKDKHLAEDLLQETFMRAYIHIHSYDHSKVKP
gi|297528524|GC56T3_0148491.05e-09 YRMLGNRHEAEDAAQEAFIRAYIHIDTYNPEMKFS
gi|138895828|GTNG_2187|Y311.05e-09 FYMVRNREHAEDLVQEVYVKVLRSYKRFKGQCSEK
gi|16078710|BSU16470|NP_531.17e-09 SVGLPKSVHKDDLMSLGMLGLYDALEKFDPSRDLK
gi|154686064|RBAM_016310531.17e-09 SVGLPKSVHKDDLMSLGMLGLYDALEKFDPGRDLK
gi|294509181|BMQ_pBM5009591.17e-09 KRYFLLGGDREDLLQEARLGLYKAVRDFKTEGMSS
gi|261404422|GYMC10_0553441.29e-09 AAVTGSSAGAADVVQETFIRVYRNLGSYDLSRPFE
gi|217959830|BCAH187_A24291.42e-09 FSLSRSHHVAEDLMQETFYRAFLYLEDYENQKVKS
gi|222095915|BCQ_2255|YP291.42e-09 FSLSRSHHVAEDLMQETFYRAFLYLEDYENQKVKS
gi|56420789|GK2254|YP_14311.42e-09 FYMVRNREQAEDLVQEVYVRVLRSYKRFKGQCSEK
gi|261417910|GYMC61_0428311.42e-09 FYMVRNREQAEDLVQEVYVRVLRSYKRFKGQCSEK
gi|297529579|GC56T3_1250311.42e-09 FYMVRNREQAEDLVQEVYVRVLRSYKRFKGQCSEK
gi|261408790|GYMC10_5011311.57e-09 MRISGDPWEAEDLLQDVMMKVIRAVETDPGKHLSN
gi|52143316|BCZK1921|YP_481.74e-09 HFLIDDKADVDDVVQEIYIQLYESLRKYDSEKPFR
gi|118477553|BALH_1878|Y571.74e-09 HFLIEDKTDVDDVVQEIYIQLYESLRKYDSEKPFR
gi|222095751|BCQ_2091|YP481.74e-09 HFLIDDKTDVDDVVQEIYIQLYESLRKYDSEKPFR
gi|42781261|BCE_2195|NP_481.74e-09 HFLIDDKADVDDVVQEIYIQLYESLRKYDSEKPFR
gi|163939932|BcerKBAB4_1481.74e-09 HFLIEDKADIDDVVQEIYIQLYESLRKYDSEKPFR
gi|217959667|BCAH187_A22481.74e-09 HFLIDDKTDVDDVVQEIYIQLYESLRKYDSEKPFR
gi|49477520|BT9727_1945|481.74e-09 HFLIEDKTDVDDVVQEIYIQLYESLRKYDSEKPFR
gi|225864098|BCA_2202|YP481.74e-09 HFLIEDKTDVDDVVQEIYIQLYESLRKYDSEKPFR
gi|218903264|BCAH820_214481.74e-09 HFLIEDKTDVDDVVQEIYIQLYESLRKYDSEKPFR
gi|218897120|BCG9842_B31481.74e-09 HFLIEDKTDVDDVVQEIYIQLYESLRKYDSEKPFR
gi|301053658|BACI_c20780481.74e-09 HFLIDDKADVDDVVQEIYIQLYESLRKYDSEKPFR
gi|15616194|BH3632|NP_24461.74e-09 RYLTGSPWDGEDLYQETLVKAFGSLYQRWQPTNPK
gi|138894123|GTNG_0449|Y432.11e-09 AAVTGSSANAADAVQETFIRVYDHIGRFDPAKPFR
gi|288555447|BpOF4_12185452.11e-09 FSYVHQQDIAEDLAQEVFVKVYQKIDQFEQRASLK
gi|15614994|BH2431|NP_24542.32e-09 SVGLPRSVSKDDLISHGMLGLLDALEKFNPDRDLK
gi|30262705|BA2732|NP_84422.56e-09 IWIIKEQTVAEELAQEVFLQLYHSDWKAIENLRAW
gi|227814455|BAMEG_1863|422.56e-09 IWIIKEQTVAEELAQEVFLQLYHSDWKAIENLRAW
gi|49185553|BAS2545|YP_0422.56e-09 IWIIKEQTVAEELAQEVFLQLYHSDWKAIENLRAW
gi|52142774|BCZK2466|YP_422.56e-09 IWIIKEQTVAEELAQEVFLQLYHSDWKSIENLRAW
gi|118478099|BALH_2454|Y422.56e-09 IWIIKEQTVAEELAQEVFLQLYHSDWKAIENLRAW
gi|152977601|Bcer98_3939422.56e-09 LWIVKNQPIAEELAQEVFLQLYHSDWKAIENIPGW
gi|218903856|BCAH820_274422.56e-09 IWIIKEQTVAEELAQEVFLQLYHSDWKAIENLCAW
gi|229603088|BAA_2796|YP422.56e-09 IWIIKEQTVAEELAQEVFLQLYHSDWKAIENLRAW
gi|47528023|GBAA2732|YP_422.56e-09 IWIIKEQTVAEELAQEVFLQLYHSDWKAIENLRAW
gi|49477843|BT9727_2501|422.56e-09 IWIIKEQTVAEELAQEVFLQLYHSDWKAIENLRAW
gi|225864707|BCA_2814|YP422.56e-09 IWIIKEQTVAEELAQEVFLQLYHSDWKAIENLRAW
gi|222096241|BCQ_2581|YP422.56e-09 IWIIKEQTVAEELAQEVFLQLYHSDWKAIENLRAW
gi|301054256|BACI_c26970422.56e-09 IWIIKEQTVAEELAQEVFLQLYHSDWKAIENLRAW
gi|261409947|GYMC10_6177302.56e-09 LSLSRDEHVAEELTQETFFKALKHIDSFQGTCKLS
gi|157691378|BPUM_0588|Y442.56e-09 FLYTRNKEDSLDAVQETVIKAFKHLSGLKEPAYFS
gi|172056180|Exig_0136|Y462.56e-09 FRVLRDRMEAEDATQEAFIRVFTKIESYNAQWKFR
gi|217957742|BCAH187_A02343.09e-09 LAKGAIKEDAEDIIQNTFYKVYTLLDDLTENNIRP
gi|229601254|BAA_0200|YP333.09e-09 LAKGAIKEDAEDIIQNTFYKVYTLLDDLTENNIRP
gi|52145050|BCZK0162|YP_333.09e-09 LAKGAIKEDAEDIIQNTFYKVYTLLDSLTEDNIRP
gi|49183204|BAS0171|YP_0333.09e-09 LAKGAIKEDAEDIIQNTFYKVYTLLDDLTENNIRP
gi|227812842|BAMEG_0200|333.09e-09 LAKGAIKEDAEDIIQNTFYKVYTLLDDLTENNIRP
gi|225862220|BCA_0212|YP343.09e-09 LAKGAIKEDAEDIIQNTFYKVYTLLDSLTEDNIRP
gi|163938169|BcerKBAB4_0333.09e-09 LAKGAIKEDAEDIIQNTFYKVYTLLDDLTEGNIRP
gi|222093937|BCQ_0193|YP333.09e-09 LAKGAIKEDAEDIIQNTFYKVYTLLDDLTENNIRP
gi|47525427|GBAA0169|YP_333.09e-09 LAKGAIKEDAEDIIQNTFYKVYTLLDDLTENNIRP
gi|30260357|BA0169|NP_84333.09e-09 LAKGAIKEDAEDIIQNTFYKVYTLLDDLTENNIRP
gi|218901372|BCAH820_019333.09e-09 LAKGAIKEDAEDIIQNTFYKVYTLLDDLTENNIRP
gi|118475937|BALH_0169|Y343.09e-09 LAKGAIKEDAEDIIQNTFYKVYTLLDNLTEDNIRP
gi|169829988|Bsph_4570|Y463.09e-09 YRMLGNKQESEDIAQEAFVRAYMNLHTFDQKRKFS
gi|42779274|BCE_0193|NP_333.09e-09 LAKGAIKEDAEDIIQNTFYKVYTLLDSLTEDNIRP
gi|288556517|BpOF4_17595333.09e-09 LVRGAVKEDAEDIIQNTFYKVYTLLDDLTESNLRP
gi|169827960|Bsph_2435|Y353.09e-09 VHQTKNMSEAEDIVQDVFMTLMKQRKPFDHEDHLK
gi|261404968|GYMC10_1112493.40e-09 YSVLGDFHEAQDAVQEAFLKCYRNLHTLNDPAKLG
gi|261406319|GYMC10_24761143.73e-09 LYVVRDHAAVEDIIQESFIKVITSKPKFETESKMR
gi|218896046|BCG9842_B42424.10e-09 IWIVKDQSIAEELAQEVFLQLYRSDWKGIENIPGW
gi|218233874|BCB4264_A10424.10e-09 IWIVKDQSIAEELAQEVFLQLYRSDWKGIENIPGW
gi|163941054|BcerKBAB4_3424.10e-09 IWIVKDQSIAEELAQEVFLQLYRSDWKVIENIPGW
gi|296501706|BMB171_C086424.10e-09 IWIVKDQSIAEELAQEVFLQLYRSDWKGIKNIPGW
gi|218232506|BCB4264_A54314.49e-09 YKLAKTKEDAEDILQETWIKVFSSRHQLSYVDKRV
gi|296506459|BMB171_P007974.49e-09 YKNKHPDIEFDDLVQEGNEGMLRAMEDFNPDLGYC
gi|67078088|pE33L466_021974.49e-09 YKNKHPDIEFDDLVQEGNEGMLRAMEDFNPDLGYC
gi|261406207|GYMC10_2363435.39e-09 YFLTKQHALADDIAQEAFIKAYYGIHTFRGQATLK
gi|294498777|BMQ_2014|YP476.46e-09 YRLTNSSDIAEEAVQEVFIKLWRGKGVYSDGKGKF
gi|294497028|BMQ_0193|YP466.46e-09 YRMLGNREEAQDAAQEAFIRAYVNIHSYDTSKKFS
gi|295704098|BMD_1970|YP476.46e-09 YRLTNSSDIAEEAVQEVFIKLWRGKGVYSDEKGKF
gi|295702393|BMD_0187|YP466.46e-09 YRMLGNREEAQDAAQEAFIRAYVNIHSYDTSKKFS
gi|255767497|BSU23100|NP317.72e-09 FYMVKDKNQTEDLLQEVYIRVLNSYHTFEGRSSEK
gi|157691562|BPUM_0780|Y487.72e-09 YKMTGSRELAEEVLQEVFIKLWRGIGEYHTDKGKF
gi|294509114|BMQ_pBM5002427.72e-09 VWIVKNQMIAEELAQEVFLQLYRNDWKSIENVPGW
gi|227813117|BAMEG_0515|548.44e-09 AIEQETNLNMDDLIQSGMLGLVTARRDFKTELGFK
gi|229600567|BAA_4139|YP548.44e-09 AIEQETNLNMDDLIQSGMLGLVTARRDFKTELGFK
gi|47529410|GBAA4115|YP_398.44e-09 AIEQETNLNMDDLIQSGMLGLVTARRDFKTELGFK
gi|30263977|BA4115|NP_84398.44e-09 AIEQETNLNMDDLIQSGMLGLVTARRDFKTELGFK
gi|49186821|BAS3823|YP_0548.44e-09 AIEQETNLNMDDLIQSGMLGLVTARRDFKTELGFK
gi|218906428|BCAH820_534319.21e-09 IKKLGIYQDYEEYYQCGLIGLWYAYERYDAKKGSF
gi|261407370|GYMC10_3567389.21e-09 FAITRNTHTADDVAQDVFIKAYQHFASFRGEASVK
gi|15614178|BH1615|NP_24439.21e-09 FQLGVSPFAVEDISQEVFIKVYRFLHKHDRGKFTT
gi|154685892|RBAM_014590331.19e-08 YRRTHHAETAKDLAQDTFMKAFNGLDSFKGHSSIR
gi|261407639|GYMC10_3840571.19e-08 RAITRESYLAEDVVQDALIRAFMHLGKLVDARRFL
gi|229917320|EAT1b_1595|461.30e-08 YKILYDRGEAEDAAQEAFIRAYTRIDTYDAQYKFK
gi|56962021|ABC0239|YP_1461.30e-08 YRMVGHVHEAQDIAQEAFLRAYTNLDKFDTTRKFS
gi|23098724|OB1269|NP_69361.42e-08 FNYVKDKETAKDMVQETFIKCYEKLDEFRNESNLK
gi|15612826|BH0263|NP_24461.54e-08 YRMVGNVHEAQDVAQEAFLRAYTNIDTYDIQRKFS
gi|23100811|OB3356|NP_69411.68e-08 YLLVKDHQLAEEAVQDTFITAFEKIHQLEDAAKLK
gi|15615679|BH3117|NP_24291.68e-08 LFVTKSTWDAEDLAQETWLKAIETLKKQGHQNPEA
gi|152977451|Bcer98_3783311.82e-08 MKRLCLYKDYEEFYQCGLIGLWMAYERYEEEKGSF
gi|138894766|GTNG_1100|Y561.82e-08 SATLPSSVPKEELVSLGLVGLYDALEKFDPSRDLK
gi|294497918|BMQ_1151|YP311.82e-08 IKKFHIYKDYDEYYQIALIGLWRAYQKFDESKGSF
gi|295703274|BMD_1138|YP311.82e-08 IKKFHIYKDYDEYYQIALIGLWRAYQKFDENKGSF
gi|56963737|ABC1972|YP_1441.82e-08 LKITLKPSLADDLTQETMTKAIEKIHLYKGRSKFS
gi|261406097|GYMC10_2252561.98e-08 WRLLNQRQDAEDAVQEIMVKAYQKLETYKPETSFS
gi|288554775|BpOF4_08800462.15e-08 YRMVGNAHEAQDVAQEAFLRAYTNLDRFDTNRKFS
gi|297582837|Bsel_0515|Y312.15e-08 FYLVRHRETAEELVQEVYIKVLNSFETFEGKSTEK
gi|56419781|GK1246|YP_14542.54e-08 SATLPSSVPKDELVSLGLVGLYDALEKFDPSRDLK
gi|261419446|GYMC61_2030542.54e-08 SATLPSSVPKDELVSLGLVGLYDALEKFDPSRDLK
gi|52080075|BL02968|YP_0352.54e-08 YRRTHQLETAKDLAQDTFLKAFAGLESFRGHSSIK
gi|52785449|BLi01689|YP_352.54e-08 YRRTHQLETAKDLAQDTFLKAFAGLESFRGHSSIK
gi|218848158|BCG9842_003722.54e-08 SFPCYGNCDLMEMIQEGTIGLMKGLEDYDYTKGNK
gi|297530579|GC56T3_2307542.54e-08 SATLPSSVPKDELVSLGLVGLYDALEKFDPSRDLK
gi|49185294|BAS2285|YP_0292.75e-08 YRILGSVMDAEDIVQDVFISLNNIENLQSIENMKA
gi|227814737|BAMEG_2147|292.75e-08 YRILGSVMDAEDIVQDVFISLNNIENLQSIENMKA
gi|30020517|BC2386|NP_83292.75e-08 YRILGSVMDAEDIVQDVFISLNNIEDPQSIENMKA
gi|30262453|BA2454|NP_84292.75e-08 YRILGSVMDAEDIVQDVFISLNNIENLQSIENMKA
gi|47527745|GBAA2454|YP_292.75e-08 YRILGSVMDAEDIVQDVFISLNNIENLQSIENMKA
gi|52143032|BCZK2206|YP_292.75e-08 YRILGSVMDAEDIVQDVFISLNNIEDLQSIENMKA
gi|49477707|BT9727_2248|292.75e-08 YRILGSVMDAEDIVQDVFISLNNIEDFQSIENMKA
gi|217959947|BCAH187_A25292.75e-08 YRILGSVMDAEDIVQDVFISLNNIEDLQSIENMKA
gi|118477845|BALH_2188|Y292.75e-08 YRILGSVMDAEDIVQDVFISLNNIEDLQSIENMKA
gi|218233483|BCB4264_A24292.75e-08 YRILGSVMDAEDIVQDVFISLNNIEDPQSIENMKA
gi|225864413|BCA_2518|YP292.75e-08 YRILGSVMDAEDIVQDVFISLNNIEDLQSIENMKA
gi|218903588|BCAH820_247292.75e-08 YRILGSVMDAEDIVQDVFISLNNIEDFQSIENMKA
gi|222096033|BCQ_2373|YP292.75e-08 YRILGSVMDAEDIVQDVFISLNNIEDLQSIENMKA
gi|229601988|BAA_2511|YP292.75e-08 YRILGSVMDAEDIVQDVFISLNNIENLQSIENMKA
gi|261405039|GYMC10_1184292.75e-08 RSIAKHAYEADDLVQDAFMKAIKEPNLAELPLHKQ
gi|16080921|BSU38700|NP_472.75e-08 LKLSLHPDLSEELVQETFLKGYIHLRSFQGRSKFS
gi|296502978|BMB171_C214292.75e-08 YRILGSVMDAEDIVQDVFISLNNIEDPQSIENMKA
gi|301053967|BACI_c23980292.75e-08 YRILGSVMDAEDIVQDVFISLNNIEDLQSIENMKA
gi|16078537|BSU14730|NP_332.98e-08 FRRTHHLETAKDLAQDTFVKALNGLASFRGHSSIR
gi|172056208|Exig_0164|Y482.98e-08 YVYVKNEQDALDVVQETVYKAFISIGQVKEPKYFV
gi|15615785|BH3223|NP_24392.98e-08 KRLTHNKWESEDLFQDSLIKIYLAMKQQPDRKMTK
gi|23098753|OB1298|NP_69323.50e-08 YQLSKSKQVAEDLTQETFLQATIHLHTFKDESVRS
gi|261406442|GYMC10_2604453.50e-08 CRMLGCKQDAQDAVQDIFIKAFTKLYTYEAKVSFS
gi|297582696|Bsel_0370|Y463.50e-08 YRMLGNMHESQDIAQEAFLRAYMNLDSYDINRKFS
gi|229917220|EAT1b_1495|443.50e-08 LQLTKDRDLAEEAMQEVFIKLWRGGGVYDESKGKF
gi|212639788|Aflv_1962|Y283.79e-08 IRKLHIRRHVDEYVQIGLIALWEAYERYDETKGSF
gi|239827399|GWCH70_20315983.79e-08 KKFSCETVPMEDLYQEAYFALHKAYEKYNPELGGS
gi|297584063|Bsel_1770|Y554.11e-08 GVHLPKNVSSDDLRSHGLMGLFDALEKFDRKRELK
gi|157694260|BPUM_3514|Y474.11e-08 MKLTLQQELAEEIMQETMLKAYMKLSSFRGDSLFS
gi|49184672|BAS1658|YP_0234.44e-08 FSILRHEEDAKDVTQEVFVKIHASLPNYQFRGLKT
gi|163939640|BcerKBAB4_1444.44e-08 FSILRHEEDAKDVTQEVFVKIHASLPNYQFRGLKT
gi|222095458|BCQ_1798|YP234.44e-08 FSILRHEEDAKDVTQEVFVKIHASLPNYQFRGLKT
gi|42780931|BCE_1861|NP_234.44e-08 FSILRHEEDAKDVTQEVFVKIHASLPNYQFRGLKT
gi|217959319|BCAH187_A19234.44e-08 FSILRHEEDAKDVTQEVFVKIHASLPNYQFRGLKT
gi|47527079|GBAA1789|YP_234.44e-08 FSILRHEEDAKDVTQEVFVKIHASLPNYQFRGLKT
gi|225863696|BCA_1798|YP234.44e-08 FSILRHEEDAKDVTQEVFVKIHASLPNYQFRGLKT
gi|30261838|BA1789|NP_84234.44e-08 FSILRHEEDAKDVTQEVFVKIHASLPNYQFRGLKT
gi|218902955|BCAH820_183234.44e-08 FSILRHEEDAKDVTQEVFVKIHASLPNYQFRGLKT
gi|49481088|BT9727_1636|234.44e-08 FSILRHEEDAKDVTQEVFVKIHASLPNYQFRGLKT
gi|218896772|BCG9842_B35234.44e-08 FSIVRHEEDAKDVTQEVFVKIHASLPNYQFRGLKT
gi|227815388|BAMEG_2801|234.44e-08 FSILRHEEDAKDVTQEVFVKIHASLPNYQFRGLKT
gi|118477262|BALH_1573|Y234.44e-08 FSILRHEEDAKDVTQEVFVKIHASLPNYQFRGLKT
gi|229602836|BAA_1861|YP234.44e-08 FSILRHEEDAKDVTQEVFVKIHASLPNYQFRGLKT
gi|52143630|BCZK1605|YP_234.44e-08 FSILRHEEDAKDVTQEVFVKIHASLPNYQFRGLKT
gi|301053373|BACI_c17850234.44e-08 FSILRHEEDAKDVTQEVFVKIHASLPNYQFRGLKT
gi|295696140|Btus_1522|Y374.44e-08 LKSRFKPAAMEDLVSFGMLGLLEAARRYDPGQETP
gi|295694973|Btus_0293|Y364.80e-08 YFYVRDRHMAEDVFQDTFLRVYSEMDKLRDEGAAK
gi|163942349|BcerKBAB4_4325.61e-08 IKIGADRKEAEDIVQDTLYKALSLMEEIPLEHLTP
gi|138894925|GTNG_1263|Y395.61e-08 YFKVQNREEAEDITQETYVRAIPYLQKNRVPPDKQ
gi|261407955|GYMC10_4162566.06e-08 AIGLPKNVSKGDLASNGVMGLIDAIEKFDYKRGLQ
gi|295696987|Btus_2417|Y346.54e-08 YMVVRDTHLAQDVVQEAWIKIWRQIKTLREPDRLG
gi|218905848|BCAH820_473327.06e-08 IKIGANRKEAEDIVQDTLYKALLLMEEIPLEHLTP
gi|217962100|BCAH187_A47327.06e-08 IKIGANRKEAEDIVQDTLYKALLLMEEIPLEHLTP
gi|49478708|BT9727_4352|327.06e-08 IKIGANRKEAEDIVQDTLYKALLLMEEIPLEHLTP
gi|222098082|BCQ_4424|YP327.06e-08 IKIGANRKEAEDIVQDTLYKALLLMEEIPLEHLTP
gi|225866598|BCA_4732|YP327.06e-08 IKIGANRKEAEDIVQDTLYKALLLMEEIPLEHLTP
gi|118479762|BALH_4199|Y327.06e-08 IKIGADRKEAEDIVQDTLYKALLLMEEIPLEHLTP
gi|294500913|BMQ_4167|YP547.06e-08 SVGLPKNIHKEELRSLGLIGLYDALEKFDYGRDLK
gi|295706259|BMD_4154|YP547.06e-08 SVGLPKNIHKEELRSLGLIGLYDALEKFDYGRDLK
gi|295705020|BMD_2904|YP467.06e-08 LKLTLDEDLCSELCQEAMMKCYVNLSSYKNEAKFS
gi|294499631|BMQ_2875|YP467.06e-08 LKLTLDEDLCSELCQEAMMKCYVNLSSYKNEAKFS
gi|169827296|Bsph_1728|Y287.61e-08 IYLVKNRTLAEDLAHEVYVRVLRSYDQFAGNSSEK
gi|169826467|Bsph_0879|Y319.53e-08 LKLTRNNVEAEDLMQEVWVKVVRYEDSVAEVEHIK
gi|23100228|OB2773|NP_69329.53e-08 LHQMQIDDKDEEYFQEGLVAMWKAFENYQPDKGPL
gi|295695225|Btus_0554|Y451.11e-07 LAIVRNPEEAADVAQESFVRAFVSLRSLKDDGAFP
gi|261409914|GYMC10_6143421.11e-07 YDKLQDSHLAEDAVQEAFTEAFANLHKLQDPRRFP
gi|295705907|BMD_3799|YP411.28e-07 RFLAQNAWDGDDIAQETFLKAQRYKGEEHKLSSAL
gi|294500554|BMQ_3807|YP441.28e-07 RFLAQNVWDGDDIAQETFLKAQRYKSEEHNLSSAL
gi|239826640|GWCH70_1138541.28e-07 AASLPKTISKQELISLGLMGLYDALEKFDPSRDLK
gi|172058539|Exig_2532|Y471.38e-07 HRFTNNDRLSEEVIQEVWMKIWNGRVDFNTDKGKF
gi|297582728|Bsel_0402|Y411.59e-07 VLLVKDRQLAEEVVQDTFITAFRKSHQLSSNDKIK
gi|23099037|OB1582|NP_69541.83e-07 ASHLPNNVVKDDIRSFGILGLYDALKKFDPSRDLK
gi|56965809|ABC4051|YP_1441.83e-07 MKYTNQHNDALDAIQEASCKAYLSIHKLNHPQYFM
gi|157694452|BPUM_3710|Y362.11e-07 YSYVKNPEDAMDVVQEAIHKALKSVHRLEDATKMH
gi|261405575|GYMC10_1726442.11e-07 YYILNNEQDAMDAAQEALIRVYTKINSYEEKAQFK
gi|261409324|GYMC10_5549572.11e-07 KIARNRPDLYEDLYQVGQMALIRLLQQYDISLGIP
gi|297582431|Bsel_0096|Y432.43e-07 YMKVGNRQDAEELLQDVFVKMVRNLAGFSGKSTFR
gi|56421959|GK3424|YP_14562.60e-07 KMARSRPDFYEDLFQIGRLSFLRLLDHYDPSQGAS
gi|261420836|GYMC61_3488562.60e-07 KMARSRPDFYEDLFQIGRLSFLRLLDHYDPKQGTS
gi|42780194|BCE_1118|NP_422.60e-07 KARLKNEEDIGDAIQETILSAFTNLKKVKEPGYFK
gi|261404205|GYMC10_0333382.60e-07 MVYLGNKQDVEEAIQETFIKLIYKAPDFRDQEHKK
gi|297531625|GC56T3_3410562.60e-07 KMARSRPDFYEDLFQIGRLSFLRLLDHYDPKQGTS
gi|169826213|Bsph_0618|Y442.60e-07 FQCGVHSNDLADVSQEVFVKLYRFLHQFKQDRFTT
gi|138897001|GTNG_3372|Y582.79e-07 KMARSRPDFYEDLFQVGRLSFLRLLEHYDPNQGTS
gi|47530207|GBAA4913|YP_482.99e-07 YRFNRDEQLSIDLVQDTFLTLERKKHMYEPEKGKI
gi|222098134|BCQ_4476|YP482.99e-07 YRFNRDEQLSIDLVQDTFLTLERKKHMYEPEKGKI
gi|218233191|BCB4264_A47382.99e-07 YRFNRDEQLSIDLVQDTFLTLERKKHMYELEKGKI
gi|30264734|BA4913|NP_84482.99e-07 YRFNRDEQLSIDLVQDTFLTLERKKHMYEPEKGKI
gi|42783844|BCE_4798|NP_482.99e-07 YRFNRDEQLSIDLVQDTFLTLERKKHMYELEKGKI
gi|217962148|BCAH187_A47382.99e-07 YRFNRDEQLSIDLVQDTFLTLERKKHMYELEKGKI
gi|227817453|BAMEG_4945|382.99e-07 YRFNRDEQLSIDLVQDTFLTLERKKHMYEPEKGKI
gi|52140841|BCZK4409|YP_382.99e-07 YRFNRDEQLSIDLVQDTFLTLERKKHMYELEKGKI
gi|218905890|BCAH820_477382.99e-07 YRFNRDEQLSIDLVQDTFLTLERKKHMYELEKGKI
gi|229604251|BAA_4924|YP482.99e-07 YRFNRDEQLSIDLVQDTFLTLERKKHMYEPEKGKI
gi|49187552|BAS4558|YP_0482.99e-07 YRFNRDEQLSIDLVQDTFLTLERKKHMYEPEKGKI
gi|118479803|BALH_4240|Y482.99e-07 YRFNRDEQLSIDLVQDTFLTLERKKHMYELEKGKI
gi|301056170|BACI_c46590482.99e-07 YRFNRDEQLSIDLVQDTFLTLERKKHMYELEKGKI
gi|49478801|BT9727_4602|443.43e-07 YSYVRNEQDALDIYQETIYEAYLSLKKLKNPEKFQ
gi|163942610|BcerKBAB4_4443.43e-07 YSYVRNEQDALDIYQETIYEAYLSLRKLKKPEKFQ
gi|295694956|Btus_0276|Y453.43e-07 QRLLGRTEPAEDLVQETFFRFVREVQRGRVPERVR
gi|229917493|EAT1b_1768|423.43e-07 YVYVKNPDDALDVVQEVAYQAFKRIGTLREPQFLK
gi|169827905|Bsph_2380|Y303.67e-07 YLYVKNKATAEDIVQDVFIAFYQKQGQFRQQASLR
gi|229916805|EAT1b_1078|303.92e-07 RQLHLHPNEVDDAAQTARIALWRAIQDGKTLGKTY
gi|169828654|Bsph_3171|Y253.92e-07 YSLTKNHSAAEDLLQDTFTKAHITLLGQDIQDIKP
gi|261407440|GYMC10_3639274.20e-07 YQMTGTVTDAEDAVQDVFVKVQSLPIKQIREPKAY
gi|163940540|BcerKBAB4_2314.80e-07 TFLTKNKWDGEDLAQEAICKVLQKYSEKEICITLL
gi|261409306|GYMC10_5531504.80e-07 LKVTMDPMLAEDTAQDTIVRCMENMNRYNGTSSFS
gi|261404261|GYMC10_0389295.13e-07 YYMLRNAQDAEDLCHDVFVTVFRQDWRSVEHTRAW
gi|169829956|Bsph_4538|Y95.13e-07 MLRNAQDAEDLCHDVFVTVFRQDWKSIEHTRAW
gi|163943299|BcerKBAB4_5485.85e-07 FAIVKNGHDTNEIVNEVYFQLWKSISKYDQSRPFL
gi|152975676|Bcer98_1911455.85e-07 MFLTKNKWDGEDLAQEAVCKVLQKYKEEDICMTLL
gi|212639538|Aflv_1712|Y445.85e-07 ASSLPKSVKKEDLKSLALLGLYDALEKFDPSRDLK
gi|261404314|GYMC10_0444376.24e-07 YSYVRNKEDALDIVQDAIHKAFLSMEKLKQTGSLK
gi|15613183|BH0620|NP_24426.66e-07 FTYVRNEHDALDVVQEAVVKGYEAYDRIKHLDYFS
gi|288555440|BpOF4_12150327.58e-07 LKMGAVKEDAEDIIQETAYQFLLYMDSVTIENVEG
gi|294500314|BMQ_3558|YP457.58e-07 KHLGTLKSYEEECVNDVLLAVWHHIDRFDSEKNTF
gi|295705661|BMD_3546|YP457.58e-07 KHLGTLKSYEEECVNDVLLAVWHHIDRFDSEKNTF
gi|16079766|BSU27120|NP_371.04e-06 FSYVKNQDDALDIVQESIKKALSSVETVRNPETIK
gi|154685119|RBAM_006640361.04e-06 YSYVKNKDDALDIVQESIQKALTSVESVKNPDVIK
gi|52079036|BL05045|YP_0361.11e-06 YSYVKNQEDALDIVQESIKKALDSVDSVRNPDTIK
gi|52784408|BLi00595|YP_361.11e-06 YSYVKNQEDALDIVQESIKKALDSVDSVRNPDTIK
gi|218900006|BCG9842_B02481.42e-06 FAIVKNRHDTNEIVNEIYFQLWKSISTYDQSRPFL
gi|23098703|OB1248|NP_69361.51e-06 IGLTKSDELADDIIQELFTKILVSPSKITEVNYMK
gi|169829522|Bsph_4082|Y402.18e-06 LTNFRIYKDYDYYRQVATIAVWRAWLKADPAKGQL
gi|295705993|BMD_3885|YP372.45e-06 FSYVKNQEDALDIMQESIKKALISIDRIKDIQSIK
gi|261404792|GYMC10_0928482.60e-06 RLYLRREEDCADAVQEAIVKSFAAMSTLKQPAYFK
gi|239826131|GWCH70_0591453.48e-06 FTILRSHHDAEDAIQNSLLEAYRTISENKEIHHFS
gi|163940227|BcerKBAB4_2294.14e-06 YRILGSVMDAEDIVHDVFISFNNMEDVQSIENMRA
gi|288554248|BpOF4_06145316.49e-06 LKKLNLYRNHEHFYQVGVCALWEAYRKFEEGKGSF
gi|15615778|BH3216|NP_24488.08e-06 LNILKDHSEAEDVSHDVFLEVFQKIEHYDATKGSV
gi|163939522|BcerKBAB4_1521.00e-05 LSTPIEKQYVDDCYNDVFTVIWFNIDQFDIEKGNL
gi|218234226|BCB4264_A16501.00e-05 LSTPIEKQYVDDCYNDVFTVIWFNIDQFDTEKGNL
gi|23099768|OB2313|NP_69261.24e-05 NTYVKNSNDTYDVIQETAYRTYEKLPELRNPQYFK
gi|169826679|Bsph_1097|Y451.38e-05 YCYVRNEADALDVFQQTVLLAIESVHQLREPKYFT
gi|169829980|Bsph_4562|Y473.96e-05 RHLNYQQQDYEECLDDVLLSIWNNIHSFDPKKNSF
gi|15616444|BH3882|NP_24295.04e-05 RTISRNEQEANDLIQDAMEKSLRCTELLDWPRHKQ
gi|15614589|BH2026|NP_24441.57e-04 LTYMGNPHDAMDAMEDMIVTLYETIDQLQKEDAFY
gi|49479940|BT9727_1587|451.14e-03 THKVLLPVQNEGLIEECVNDIFLSIWNNANKFHGE
gi|163940708|BcerKBAB4_2141.68e-03 VELKEWLYKMESGDQEAFRVIYKLTSKDIYRQ
gi|16079737|BSU26840|NP_902.45e-03 VLHFNDSAEEENFTKEATVCIRSTIKRLPEKYREA

Motif 1 block diagrams

NameLowest
p-value
   Motifs
gi|212637937|Aflv_0088|Y 4.1e-16

1
gi|294496966|BMQ_0119|YP 4.1e-16

1
gi|295705913|BMD_3805|YP 4.1e-16

1
gi|294500560|BMQ_3813|YP 4.1e-16

1
gi|295696440|Btus_1834|Y 4.1e-16

1
gi|15612678|BH0115|NP_24 4.1e-16

1
gi|169830054|Bsph_4638|Y 4.1e-16

1
gi|261409537|GYMC10_5766 4.1e-16

1
gi|295702333|BMD_0117|YP 4.1e-16

1
gi|56418624|GK0089|YP_14 5.5e-16

1
gi|56961915|ABC0133|YP_1 5.5e-16

1
gi|288554708|BpOF4_08465 5.5e-16

1
gi|138893768|GTNG_0089|Y 5.5e-16

1
gi|297528465|GC56T3_0089 5.5e-16

1
gi|261417590|GYMC61_0090 5.5e-16

1
gi|16077166|BSU00980|NP_ 7.4e-16

1
gi|295694818|Btus_0134|Y 7.4e-16

1
gi|52078593|BL03273|YP_0 7.4e-16

1
gi|157690881|BPUM_0083|Y 7.4e-16

1
gi|154684616|RBAM_001230 7.4e-16

1
gi|52783954|BLi00116|YP_ 7.4e-16

1
gi|212638845|Aflv_1004|Y 9.7e-16

1
gi|23097558|OB0103|NP_69 9.7e-16

1
gi|239825676|GWCH70_0094 1.3e-15

1
gi|172056123|Exig_0079|Y 1.3e-15

1
gi|222093864|BCQ_0107|YP 1.7e-15

1
gi|152973941|Bcer98_0088 1.7e-15

1
gi|118475864|BALH_0093|Y 1.7e-15

1
gi|47525348|GBAA0093|YP_ 1.7e-15

1
gi|217957669|BCAH187_A01 1.7e-15

1
gi|218901296|BCAH820_010 1.7e-15

1
gi|225862146|BCA_0122|YP 1.7e-15

1
gi|42779174|BCE_0093|NP_ 1.7e-15

1
gi|30018364|BC0114|NP_82 1.7e-15

1
gi|227812767|BAMEG_0109| 1.7e-15

1
gi|52145123|BCZK0089|YP_ 1.7e-15

1
gi|218895229|BCG9842_B52 1.7e-15

1
gi|30260284|BA0093|NP_84 1.7e-15

1
gi|229601909|BAA_0109|YP 1.7e-15

1
gi|163938101|BcerKBAB4_0 1.7e-15

1
gi|218231038|BCB4264_A01 1.7e-15

1
gi|49476711|BT9727_0090| 1.7e-15

1
gi|49183127|BAS0093|YP_0 1.7e-15

1
gi|169827020|Bsph_1444|Y 1.7e-15

1
gi|296500928|BMB171_C009 1.7e-15

1
gi|295696452|Btus_1846|Y 1.7e-15

1
gi|261405674|GYMC10_1825 1.7e-15

1
gi|301051831|BACI_c01200 1.7e-15

1
gi|212639646|Aflv_1820|Y 2.7e-15

1
gi|42782996|BCE_3948|NP_ 2.7e-15

1
gi|218233406|BCB4264_A40 2.7e-15

1
gi|227813187|BAMEG_0585| 2.7e-15

1
gi|163941643|BcerKBAB4_3 2.7e-15

1
gi|152976264|Bcer98_2552 2.7e-15

1
gi|56419663|GK1128|YP_14 2.7e-15

1
gi|49478441|BT9727_3645| 2.7e-15

1
gi|30263905|BA4042|NP_84 2.7e-15

1
gi|217961324|BCAH187_A39 2.7e-15

1
gi|229602177|BAA_4068|YP 2.7e-15

1
gi|30021992|BC3903|NP_83 2.7e-15

1
gi|218905033|BCAH820_391 2.7e-15

1
gi|225865885|BCA_4007|YP 2.7e-15

1
gi|47778237|GBAA4042|YP_ 2.7e-15

1
gi|222097349|BCQ_3689|YP 2.7e-15

1
gi|49186753|BAS3754|YP_0 2.7e-15

1
gi|16078597|BSU15330|NP_ 2.7e-15

1
gi|218899057|BCG9842_B12 2.7e-15

1
gi|52141585|BCZK3662|YP_ 2.7e-15

1
gi|118479123|BALH_3533|Y 2.7e-15

1
gi|297530705|GC56T3_2445 2.7e-15

1
gi|301055394|BACI_c38590 2.7e-15

1
gi|157692208|BPUM_1427|Y 2.7e-15

1
gi|239826533|GWCH70_1031 2.7e-15

1
gi|288553150|BpOF4_00620 2.7e-15

1
gi|295706362|BMD_4257|YP 2.7e-15

1
gi|56964115|ABC2350|YP_1 2.7e-15

1
gi|138894663|GTNG_0993|Y 2.7e-15

1
gi|23098931|OB1476|NP_69 2.7e-15

1
gi|52785510|BLi01751|YP_ 2.7e-15

1
gi|154685949|RBAM_015160 2.7e-15

1
gi|296504397|BMB171_C356 2.7e-15

1
gi|294501013|BMQ_4269|YP 2.7e-15

1
gi|15615117|BH2554|NP_24 2.7e-15

1
gi|261419325|GYMC61_1901 2.7e-15

1
gi|52080136|BL02256|YP_0 2.7e-15

1
gi|288555973|BpOF4_14835 3.5e-15

1
gi|15614101|BH1538|NP_24 3.5e-15

1
gi|56963560|ABC1795|YP_1 3.5e-15

1
gi|218905210|BCAH820_409 7.2e-15

1
gi|217961566|BCAH187_A42 7.2e-15

1
gi|52141420|BCZK3829|YP_ 7.2e-15

1
gi|42783188|BCE_4142|NP_ 7.2e-15

1
gi|47529588|GBAA4294|YP_ 7.2e-15

1
gi|227816852|BAMEG_4334| 7.2e-15

1
gi|118479276|BALH_3690|Y 7.2e-15

1
gi|225866059|BCA_4185|YP 7.2e-15

1
gi|16079402|BSU23450|NP_ 7.2e-15

1
gi|218899234|BCG9842_B10 7.2e-15

1
gi|30264150|BA4294|NP_84 7.2e-15

1
gi|49478518|BT9727_3813| 7.2e-15

1
gi|218234550|BCB4264_A41 7.2e-15

1
gi|222097523|BCQ_3863|YP 7.2e-15

1
gi|49186981|BAS3983|YP_0 7.2e-15

1
gi|30022159|BC4072|NP_83 7.2e-15

1
gi|163941815|BcerKBAB4_3 7.2e-15

1
gi|152976482|Bcer98_2771 7.2e-15

1
gi|229603990|BAA_4316|YP 7.2e-15

1
gi|56420843|GK2308|YP_14 7.2e-15

1
gi|157692844|BPUM_2076|Y 7.2e-15

1
gi|52080862|BL00778|YP_0 7.2e-15

1
gi|301055569|BACI_c40400 7.2e-15

1
gi|296504567|BMB171_C373 7.2e-15

1
gi|294501135|BMQ_4391|YP 7.2e-15

1
gi|295706482|BMD_4377|YP 7.2e-15

1
gi|52786234|BLi02495|YP_ 7.2e-15

1
gi|297529524|GC56T3_1195 7.2e-15

1
gi|239827600|GWCH70_2250 7.2e-15

1
gi|138895880|GTNG_2239|Y 7.2e-15

1
gi|261417856|GYMC61_0374 7.2e-15

1
gi|261405990|GYMC10_2143 7.2e-15

1
gi|154686587|RBAM_021560 7.2e-15

1
gi|229917375|EAT1b_1650| 1.1e-13

1
gi|297582430|Bsel_0095|Y 2.3e-13

1
gi|23098085|OB0630|NP_69 6.5e-13

1
gi|295696453|Btus_1847|Y 7.7e-13

1
gi|288555708|BpOF4_13500 7.7e-13

1
gi|229603939|BAA_4584|YP 1.1e-12

1
gi|49481469|BT9727_4074| 1.1e-12

1
gi|49187232|BAS4236|YP_0 1.1e-12

1
gi|222097784|BCQ_4125|YP 1.1e-12

1
gi|56421070|GK2535|YP_14 1.1e-12

1
gi|218905533|BCAH820_441 1.1e-12

1
gi|227817116|BAMEG_4602| 1.1e-12

1
gi|217961829|BCAH187_A44 1.1e-12

1
gi|225866320|BCA_4450|YP 1.1e-12

1
gi|163942095|BcerKBAB4_4 1.1e-12

1
gi|218231149|BCB4264_A44 1.1e-12

1
gi|218899507|BCG9842_B07 1.1e-12

1
gi|118479504|BALH_3926|Y 1.1e-12

1
gi|30022417|BC4336|NP_83 1.1e-12

1
gi|152976769|Bcer98_3065 1.1e-12

1
gi|30264411|BA4566|NP_84 1.1e-12

1
gi|42783467|BCE_4421|NP_ 1.1e-12

1
gi|52141167|BCZK4084|YP_ 1.1e-12

1
gi|47529862|GBAA4566|YP_ 1.1e-12

1
gi|138896107|GTNG_2470|Y 1.1e-12

1
gi|301055830|BACI_c43070 1.1e-12

1
gi|261418447|GYMC61_0982 1.1e-12

1
gi|294501329|BMQ_4591|YP 1.1e-12

1
gi|56963382|ABC1617|YP_1 1.1e-12

1
gi|239827809|GWCH70_2471 1.1e-12

1
gi|157693076|BPUM_2309|Y 1.1e-12

1
gi|295706676|BMD_4577|YP 1.1e-12

1
gi|52081127|BL02107|YP_0 1.1e-12

1
gi|261405539|GYMC10_1690 1.1e-12

1
gi|295695806|Btus_1170|Y 1.1e-12

1
gi|296504831|BMB171_C400 1.1e-12

1
gi|297582861|Bsel_0539|Y 1.1e-12

1
gi|15613848|BH1285|NP_24 1.1e-12

1
gi|297529299|GC56T3_0955 1.1e-12

1
gi|212638647|Aflv_0804|Y 1.1e-12

1
gi|52786504|BLi02769|YP_ 1.1e-12

1
gi|288555607|BpOF4_12995 1.1e-12

1
gi|255767354|BSU15320|NP 1.3e-12

1
gi|227813186|BAMEG_0584| 1.3e-12

1
gi|152976265|Bcer98_2553 1.3e-12

1
gi|218899058|BCG9842_B12 1.3e-12

1
gi|218905035|BCAH820_391 1.3e-12

1
gi|30263906|BA4043|NP_84 1.3e-12

1
gi|225865886|BCA_4008|YP 1.3e-12

1
gi|47529336|GBAA4043|YP_ 1.3e-12

1
gi|212639647|Aflv_1821|Y 1.3e-12

1
gi|52141583|BCZK3663|YP_ 1.3e-12

1
gi|42782997|BCE_3949|NP_ 1.3e-12

1
gi|217961326|BCAH187_A39 1.3e-12

1
gi|222097350|BCQ_3690|YP 1.3e-12

1
gi|229601447|BAA_4069|YP 1.3e-12

1
gi|30021993|BC3904|NP_83 1.3e-12

1
gi|162382776|BALH_3534|Y 1.3e-12

1
gi|218234749|BCB4264_A40 1.3e-12

1
gi|49186754|BAS3755|YP_0 1.3e-12

1
gi|163941644|BcerKBAB4_3 1.3e-12

1
gi|49478442|BT9727_3646| 1.3e-12

1
gi|56419662|GK1127|YP_14 1.3e-12

1
gi|294501014|BMQ_4270|YP 1.3e-12

1
gi|157692207|BPUM_1426|Y 1.3e-12

1
gi|15615119|BH2556|NP_24 1.3e-12

1
gi|296504398|BMB171_C356 1.3e-12

1
gi|52785509|BLi01750|YP_ 1.3e-12

1
gi|154685948|RBAM_015150 1.3e-12

1
gi|52080135|BL02255|YP_0 1.3e-12

1
gi|288553151|BpOF4_00625 1.3e-12

1
gi|138894662|GTNG_0992|Y 1.3e-12

1
gi|23098930|OB1475|NP_69 1.3e-12

1
gi|239826532|GWCH70_1030 1.3e-12

1
gi|56964116|ABC2351|YP_1 1.3e-12

1
gi|297530706|GC56T3_2446 1.3e-12

1
gi|295706363|BMD_4258|YP 1.3e-12

1
gi|261419324|GYMC61_1900 1.3e-12

1
gi|301055395|BACI_c38600 1.3e-12

1
gi|229917800|EAT1b_2078| 2e-12

1
gi|172058807|Exig_2804|Y 2e-12

1
gi|227816484|BAMEG_3941| 3.2e-12

1
gi|229603531|BAA_0728|YP 3.2e-12

1
gi|42779792|BCE_0714|NP_ 3.2e-12

1
gi|52144667|BCZK0557|YP_ 3.2e-12

1
gi|47525925|GBAA0646|YP_ 3.2e-12

1
gi|255767573|BSU25200|NP 3.2e-12

1
gi|218895700|BCG9842_B46 3.2e-12

1
gi|218232155|BCB4264_A06 3.2e-12

1
gi|30260800|BA0646|NP_84 3.2e-12

1
gi|30018830|BC0647|NP_83 3.2e-12

1
gi|49183638|BAS0613|YP_0 3.2e-12

1
gi|163938569|BcerKBAB4_0 3.2e-12

1
gi|118476332|BALH_0588|Y 3.2e-12

1
gi|222094400|BCQ_0714|YP 3.2e-12

1
gi|225862624|BCA_0684|YP 3.2e-12

1
gi|218901842|BCAH820_070 3.2e-12

1
gi|157693020|BPUM_2253|Y 3.2e-12

1
gi|154686781|RBAM_023510 3.2e-12

1
gi|163119552|BL03682|YP_ 3.2e-12

1
gi|52786447|BLi02712|YP_ 3.2e-12

1
gi|218232261|BCB4264_A44 3.7e-12

1
gi|52141207|BCZK4042|YP_ 3.7e-12

1
gi|42783418|BCE_4372|NP_ 3.7e-12

1
gi|30264362|BA4515|NP_84 3.7e-12

1
gi|218899458|BCG9842_B08 3.7e-12

1
gi|218905429|BCAH820_431 3.7e-12

1
gi|229601154|BAA_4536|YP 3.7e-12

1
gi|30022370|BC4289|NP_83 3.7e-12

1
gi|152976724|Bcer98_3019 3.7e-12

1
gi|163942050|BcerKBAB4_4 3.7e-12

1
gi|56421017|GK2482|YP_14 3.7e-12

1
gi|212638699|Aflv_0856|Y 3.7e-12

1
gi|118479464|BALH_3885|Y 3.7e-12

1
gi|217961783|BCAH187_A44 3.7e-12

1
gi|47529811|GBAA4515|YP_ 3.7e-12

1
gi|49187190|BAS4194|YP_0 3.7e-12

1
gi|225866273|BCA_4403|YP 3.7e-12

1
gi|227817068|BAMEG_4554| 3.7e-12

1
gi|49481307|BT9727_4032| 3.7e-12

1
gi|297584635|Bsel_2346|Y 3.7e-12

1
gi|295706627|BMD_4528|YP 3.7e-12

1
gi|297529352|GC56T3_1008 3.7e-12

1
gi|261417657|GYMC61_0157 3.7e-12

1
gi|56963455|ABC1690|YP_1 3.7e-12

1
gi|239827752|GWCH70_2414 3.7e-12

1
gi|229916320|EAT1b_0589| 3.7e-12

1
gi|288555754|BpOF4_13730 3.7e-12

1
gi|169829158|Bsph_3702|Y 3.7e-12

1
gi|301055785|BACI_c42620 3.7e-12

1
gi|172056869|Exig_0832|Y 3.7e-12

1
gi|261407775|GYMC10_3981 3.7e-12

1
gi|261405623|GYMC10_1774 3.7e-12

1
gi|23099399|OB1944|NP_69 3.7e-12

1
gi|294501280|BMQ_4542|YP 3.7e-12

1
gi|138896056|GTNG_2419|Y 3.7e-12

1
gi|15613939|BH1376|NP_24 3.7e-12

1
gi|296504786|BMB171_C395 3.7e-12

1
gi|297582645|Bsel_0319|Y 5e-12

1
gi|294500199|BMQ_3443|YP 6.7e-12

1
gi|294497070|BMQ_0235|YP 7.7e-12

1
gi|295702435|BMD_0229|YP 7.7e-12

1
gi|295695448|Btus_0783|Y 8.9e-12

1
gi|218232670|BCB4264_A10 1.2e-11

1
gi|218896055|BCG9842_B42 1.2e-11

1
gi|225862940|BCA_1029|YP 1.2e-11

1
gi|227816152|BAMEG_3579| 1.2e-11

1
gi|229604478|BAA_1086|YP 1.2e-11

1
gi|30261116|BA0992|NP_84 1.2e-11

1
gi|47526271|GBAA0992|YP_ 1.2e-11

1
gi|118476614|BALH_0889|Y 1.2e-11

1
gi|52144331|BCZK0896|YP_ 1.2e-11

1
gi|218902186|BCAH820_106 1.2e-11

1
gi|30019159|BC1004|NP_83 1.2e-11

1
gi|222094730|BCQ_1068|YP 1.2e-11

1
gi|217958581|BCAH187_A11 1.2e-11

1
gi|49480184|BT9727_0913| 1.2e-11

1
gi|49183950|BAS0928|YP_0 1.2e-11

1
gi|42780162|BCE_1086|NP_ 1.2e-11

1
gi|163938900|BcerKBAB4_0 1.2e-11

1
gi|301052635|BACI_c10250 1.2e-11

1
gi|296501716|BMB171_C087 1.2e-11

1
gi|152976319|Bcer98_2607 1.4e-11

1
gi|169829726|Bsph_4295|Y 1.4e-11

1
gi|52784380|BLi00560|YP_ 1.6e-11

1
gi|52079008|BL02208|YP_0 1.6e-11

1
gi|23099294|OB1839|NP_69 1.6e-11

1
gi|169829306|Bsph_3856|Y 2.3e-11

1
gi|163940286|BcerKBAB4_2 2.6e-11

1
gi|255767137|BSU04730|NP 3e-11

1
gi|154686834|RBAM_024040 3e-11

1
gi|154684976|RBAM_005070 3e-11

1
gi|157691239|BPUM_0446|Y 3e-11

1
gi|42780207|BCE_1131|NP_ 3.4e-11

1
gi|217958624|BCAH187_A12 3.4e-11

1
gi|222094769|BCQ_1107|YP 3.4e-11

1
gi|163938949|BcerKBAB4_0 3.4e-11

1
gi|52144286|BCZK0942|YP_ 3.4e-11

1
gi|23099454|OB1999|NP_69 3.4e-11

1
gi|225864482|BCA_2587|YP 3.9e-11

1
gi|118477905|BALH_2250|Y 3.9e-11

1
gi|42781595|BCE_2534|NP_ 3.9e-11

1
gi|217959986|BCAH187_A25 3.9e-11

1
gi|218903633|BCAH820_251 3.9e-11

1
gi|52142997|BCZK2243|YP_ 3.9e-11

1
gi|218231851|BCB4264_A24 3.9e-11

1
gi|30020599|BC2469|NP_83 3.9e-11

1
gi|222096073|BCQ_2413|YP 3.9e-11

1
gi|49479242|BT9727_2287| 3.9e-11

1
gi|218897485|BCG9842_B28 3.9e-11

1
gi|52787786|BLi04109|YP_ 3.9e-11

1
gi|301054038|BACI_c24720 3.9e-11

1
gi|261409476|GYMC10_5703 3.9e-11

1
gi|296503062|BMB171_C223 3.9e-11

1
gi|52082396|BL00940|YP_0 3.9e-11

1
gi|261405673|GYMC10_1824 5e-11

1
gi|288554854|BpOF4_09205 5e-11

1
gi|49476853|BT9727_0558| 8.2e-11

1
gi|169827019|Bsph_1443|Y 8.2e-11

1
gi|118476646|BALH_0922|Y 1.3e-10

1
gi|30261155|BA1032|NP_84 1.3e-10

1
gi|218902228|BCAH820_111 1.3e-10

1
gi|225862980|BCA_1069|YP 1.3e-10

1
gi|49477062|BT9727_0953| 1.3e-10

1
gi|227816114|BAMEG_3540| 1.3e-10

1
gi|47777889|GBAA1032|YP_ 1.3e-10

1
gi|218231966|BCB4264_A10 1.3e-10

1
gi|218896095|BCG9842_B42 1.3e-10

1
gi|229604778|BAA_1124|YP 1.3e-10

1
gi|49183986|BAS0964|YP_0 1.3e-10

1
gi|301052678|BACI_c10700 1.3e-10

1
gi|296501752|BMB171_C091 1.3e-10

1
gi|212638144|Aflv_0295|Y 1.5e-10

1
gi|56962590|ABC0816|YP_1 1.5e-10

1
gi|295696809|Btus_2226|Y 1.5e-10

1
gi|16077241|BSU01730|NP_ 1.9e-10

1
gi|52784027|BLi00199|YP_ 1.9e-10

1
gi|154684695|RBAM_002260 1.9e-10

1
gi|157690957|BPUM_0160|Y 1.9e-10

1
gi|52078665|BL02699|YP_0 1.9e-10

1
gi|261409365|GYMC10_5592 1.9e-10

1
gi|217958232|BCAH187_A07 2.1e-10

1
gi|52786190|BLi02449|YP_ 2.1e-10

1
gi|157692810|BPUM_2042|Y 2.1e-10

1
gi|52080819|BL00651|YP_0 2.1e-10

1
gi|239827551|GWCH70_2200 2.6e-10

1
gi|49480428|BT9727_5044| 2.9e-10

1
gi|49188198|BAS5212|YP_0 2.9e-10

1
gi|218906540|BCAH820_545 2.9e-10

1
gi|222097738|BCQ_4079|YP 2.9e-10

1
gi|225867344|BCA_5512|YP 2.9e-10

1
gi|227818128|BAMEG_5654| 2.9e-10

1
gi|217962852|BCAH187_A55 2.9e-10

1
gi|42784537|BCE_5492|NP_ 2.9e-10

1
gi|218900489|BCG9842_B54 2.9e-10

1
gi|118480394|BALH_4859|Y 2.9e-10

1
gi|52140200|BCZK5060|YP_ 2.9e-10

1
gi|30023393|BC5363|NP_83 2.9e-10

1
gi|30265385|BA5610|NP_84 2.9e-10

1
gi|229601723|BAA_5636|YP 2.9e-10

1
gi|222098834|BCQ_5203|YP 2.9e-10

1
gi|47530932|GBAA5610|YP_ 2.9e-10

1
gi|301056831|BACI_c53580 2.9e-10

1
gi|296505785|BMB171_C495 2.9e-10

1
gi|261406063|GYMC10_2217 3.3e-10

1
gi|30019269|BC1114|NP_83 3.7e-10

1
gi|30261223|BA1113|NP_84 3.7e-10

1
gi|49184055|BAS1035|YP_0 3.7e-10

1
gi|218896153|BCG9842_B41 3.7e-10

1
gi|47526385|GBAA1113|YP_ 3.7e-10

1
gi|218902311|BCAH820_119 3.7e-10

1
gi|229602397|BAA_1198|YP 3.7e-10

1
gi|225863070|BCA_1159|YP 3.7e-10

1
gi|163939015|BcerKBAB4_1 3.7e-10

1
gi|227816040|BAMEG_3466| 3.7e-10

1
gi|222094839|BCQ_1177|YP 3.7e-10

1
gi|218232533|BCB4264_A11 3.7e-10

1
gi|217958692|BCAH187_A12 3.7e-10

1
gi|42780290|BCE_1215|NP_ 3.7e-10

1
gi|52144214|BCZK1013|YP_ 3.7e-10

1
gi|49477092|BT9727_1012| 3.7e-10

1
gi|138893826|GTNG_0147|Y 3.7e-10

1
gi|301052754|BACI_c11460 3.7e-10

1
gi|15613092|BH0529|NP_24 3.7e-10

1
gi|261404455|GYMC10_0586 3.7e-10

1
gi|261408152|GYMC10_4361 3.7e-10

1
gi|169827149|Bsph_1579|Y 3.7e-10

1
gi|227815066|BAMEG_2477| 4.1e-10

1
gi|49184977|BAS1966|YP_0 4.1e-10

1
gi|229602619|BAA_2180|YP 4.1e-10

1
gi|30262135|BA2114|NP_84 4.1e-10

1
gi|30020245|BC2108|NP_83 4.1e-10

1
gi|47527408|GBAA2114|YP_ 4.1e-10

1
gi|218232753|BCB4264_A21 4.1e-10

1
gi|296502728|BMB171_C189 4.1e-10

1
gi|157692327|BPUM_1546|Y 4.6e-10

1
gi|261406105|GYMC10_2260 4.6e-10

1
gi|295695216|Btus_0545|Y 4.6e-10

1
gi|212637996|Aflv_0147|Y 5.1e-10

1
gi|239825735|GWCH70_0154 5.1e-10

1
gi|52785627|BLi01868|YP_ 5.1e-10

1
gi|52080250|BL01246|YP_0 5.1e-10

1
gi|261406462|GYMC10_2625 5.6e-10

1
gi|23097683|OB0228|NP_69 5.6e-10

1
gi|218233984|BCB4264_A53 6.3e-10

1
gi|225867222|BCA_5390|YP 6.3e-10

1
gi|30023283|BC5251|NP_83 6.3e-10

1
gi|227814691|BAMEG_2101| 6.3e-10

1
gi|227818013|BAMEG_5539| 6.3e-10

1
gi|30265276|BA5493|NP_84 6.3e-10

1
gi|47527789|GBAA2502|YP_ 6.3e-10

1
gi|217962737|BCAH187_A54 6.3e-10

1
gi|222098712|BCQ_5081|YP 6.3e-10

1
gi|229603576|BAA_5520|YP 6.3e-10

1
gi|49481227|BT9727_4932| 6.3e-10

1
gi|163942935|BcerKBAB4_5 6.3e-10

1
gi|218900375|BCG9842_B55 6.3e-10

1
gi|49185332|BAS2323|YP_0 6.3e-10

1
gi|30262499|BA2502|NP_84 6.3e-10

1
gi|42784415|BCE_5370|NP_ 6.3e-10

1
gi|52140312|BCZK4947|YP_ 6.3e-10

1
gi|47530811|GBAA5493|YP_ 6.3e-10

1
gi|49188088|BAS5102|YP_0 6.3e-10

1
gi|229604897|BAA_2557|YP 6.3e-10

1
gi|295704249|BMD_2121|YP 6.3e-10

1
gi|296505675|BMB171_C484 6.3e-10

1
gi|294498927|BMQ_2164|YP 6.3e-10

1
gi|301056717|BACI_c52440 6.3e-10

1
gi|15613235|BH0672|NP_24 6.3e-10

1
gi|288556053|BpOF4_15235 7e-10

1
gi|227814227|BAMEG_1635| 7.7e-10

1
gi|49185764|BAS2758|YP_0 7.7e-10

1
gi|218904082|BCAH820_296 7.7e-10

1
gi|161486563|BA2970|NP_8 7.7e-10

1
gi|229602282|BAA_3022|YP 7.7e-10

1
gi|161611198|GBAA2970|YP 7.7e-10

1
gi|15615924|BH3362|NP_24 7.7e-10

1
gi|49478105|BT9727_3026| 8.6e-10

1
gi|218904418|BCAH820_330 8.6e-10

1
gi|52142270|BCZK2972|YP_ 8.6e-10

1
gi|47528609|GBAA3324|YP_ 8.6e-10

1
gi|225865247|BCA_3356|YP 8.6e-10

1
gi|227813895|BAMEG_1301| 8.6e-10

1
gi|229604117|BAA_3359|YP 8.6e-10

1
gi|49186087|BAS3082|YP_0 8.6e-10

1
gi|30263235|BA3324|NP_84 8.6e-10

1
gi|163940993|BcerKBAB4_3 8.6e-10

1
gi|301054766|BACI_c32210 8.6e-10

1
gi|56420261|GK1726|YP_14 9.5e-10

1
gi|23100547|OB3092|NP_69 9.5e-10

1
gi|56964615|ABC2851|YP_1 9.5e-10

1
gi|56418685|GK0150|YP_14 1.1e-09

1
gi|16078017|BSU09520|NP_ 1.1e-09

1
gi|288553039|BpOF4_00065 1.1e-09

1
gi|52784792|BLi01020|YP_ 1.1e-09

1
gi|154686555|RBAM_021240 1.1e-09

1
gi|261417650|GYMC61_0150 1.1e-09

1
gi|52079432|BL02851|YP_0 1.1e-09

1
gi|157691684|BPUM_0902|Y 1.1e-09

1
gi|154685410|RBAM_009760 1.1e-09

1
gi|297528524|GC56T3_0148 1.1e-09

1
gi|138895828|GTNG_2187|Y 1.1e-09

1
gi|16078710|BSU16470|NP_ 1.2e-09

1
gi|154686064|RBAM_016310 1.2e-09

1
gi|294509181|BMQ_pBM5009 1.2e-09

1
gi|261404422|GYMC10_0553 1.3e-09

1
gi|217959830|BCAH187_A24 1.4e-09

1
gi|222095915|BCQ_2255|YP 1.4e-09

1
gi|56420789|GK2254|YP_14 1.4e-09

1
gi|261417910|GYMC61_0428 1.4e-09

1
gi|297529579|GC56T3_1250 1.4e-09

1
gi|261408790|GYMC10_5011 1.6e-09

1
gi|52143316|BCZK1921|YP_ 1.7e-09

1
gi|118477553|BALH_1878|Y 1.7e-09

1
gi|222095751|BCQ_2091|YP 1.7e-09

1
gi|42781261|BCE_2195|NP_ 1.7e-09

1
gi|163939932|BcerKBAB4_1 1.7e-09

1
gi|217959667|BCAH187_A22 1.7e-09

1
gi|49477520|BT9727_1945| 1.7e-09

1
gi|225864098|BCA_2202|YP 1.7e-09

1
gi|218903264|BCAH820_214 1.7e-09

1
gi|218897120|BCG9842_B31 1.7e-09

1
gi|301053658|BACI_c20780 1.7e-09

1
gi|15616194|BH3632|NP_24 1.7e-09

1
gi|138894123|GTNG_0449|Y 2.1e-09

1
gi|288555447|BpOF4_12185 2.1e-09

1
gi|15614994|BH2431|NP_24 2.3e-09

1
gi|30262705|BA2732|NP_84 2.6e-09

1
gi|227814455|BAMEG_1863| 2.6e-09

1
gi|49185553|BAS2545|YP_0 2.6e-09

1
gi|52142774|BCZK2466|YP_ 2.6e-09

1
gi|118478099|BALH_2454|Y 2.6e-09

1
gi|152977601|Bcer98_3939 2.6e-09

1
gi|218903856|BCAH820_274 2.6e-09

1
gi|229603088|BAA_2796|YP 2.6e-09

1
gi|47528023|GBAA2732|YP_ 2.6e-09

1
gi|49477843|BT9727_2501| 2.6e-09

1
gi|225864707|BCA_2814|YP 2.6e-09

1
gi|222096241|BCQ_2581|YP 2.6e-09

1
gi|301054256|BACI_c26970 2.6e-09

1
gi|261409947|GYMC10_6177 2.6e-09

1
gi|157691378|BPUM_0588|Y 2.6e-09

1
gi|172056180|Exig_0136|Y 2.6e-09

1
gi|217957742|BCAH187_A02 3.1e-09

1
gi|229601254|BAA_0200|YP 3.1e-09

1
gi|52145050|BCZK0162|YP_ 3.1e-09

1
gi|49183204|BAS0171|YP_0 3.1e-09

1
gi|227812842|BAMEG_0200| 3.1e-09

1
gi|225862220|BCA_0212|YP 3.1e-09

1
gi|163938169|BcerKBAB4_0 3.1e-09

1
gi|222093937|BCQ_0193|YP 3.1e-09

1
gi|47525427|GBAA0169|YP_ 3.1e-09

1
gi|30260357|BA0169|NP_84 3.1e-09

1
gi|218901372|BCAH820_019 3.1e-09

1
gi|118475937|BALH_0169|Y 3.1e-09

1
gi|169829988|Bsph_4570|Y 3.1e-09

1
gi|42779274|BCE_0193|NP_ 3.1e-09

1
gi|288556517|BpOF4_17595 3.1e-09

1
gi|169827960|Bsph_2435|Y 3.1e-09

1
gi|261404968|GYMC10_1112 3.4e-09

1
gi|261406319|GYMC10_2476 3.7e-09

1
gi|218896046|BCG9842_B42 4.1e-09

1
gi|218233874|BCB4264_A10 4.1e-09

1
gi|163941054|BcerKBAB4_3 4.1e-09

1
gi|296501706|BMB171_C086 4.1e-09

1
gi|218232506|BCB4264_A54 4.5e-09

1
gi|296506459|BMB171_P007 4.5e-09

1
gi|67078088|pE33L466_021 4.5e-09

1
gi|261406207|GYMC10_2363 5.4e-09

1
gi|294498777|BMQ_2014|YP 6.5e-09

1
gi|294497028|BMQ_0193|YP 6.5e-09

1
gi|295704098|BMD_1970|YP 6.5e-09

1
gi|295702393|BMD_0187|YP 6.5e-09

1
gi|255767497|BSU23100|NP 7.7e-09

1
gi|157691562|BPUM_0780|Y 7.7e-09

1
gi|294509114|BMQ_pBM5002 7.7e-09

1
gi|227813117|BAMEG_0515| 8.4e-09

1
gi|229600567|BAA_4139|YP 8.4e-09

1
gi|47529410|GBAA4115|YP_ 8.4e-09

1
gi|30263977|BA4115|NP_84 8.4e-09

1
gi|49186821|BAS3823|YP_0 8.4e-09

1
gi|218906428|BCAH820_534 9.2e-09

1
gi|261407370|GYMC10_3567 9.2e-09

1
gi|15614178|BH1615|NP_24 9.2e-09

1
gi|154685892|RBAM_014590 1.2e-08

1
gi|261407639|GYMC10_3840 1.2e-08

1
gi|229917320|EAT1b_1595| 1.3e-08

1
gi|56962021|ABC0239|YP_1 1.3e-08

1
gi|23098724|OB1269|NP_69 1.4e-08

1
gi|15612826|BH0263|NP_24 1.5e-08

1
gi|23100811|OB3356|NP_69 1.7e-08

1
gi|15615679|BH3117|NP_24 1.7e-08

1
gi|152977451|Bcer98_3783 1.8e-08

1
gi|138894766|GTNG_1100|Y 1.8e-08

1
gi|294497918|BMQ_1151|YP 1.8e-08

1
gi|295703274|BMD_1138|YP 1.8e-08

1
gi|56963737|ABC1972|YP_1 1.8e-08

1
gi|261406097|GYMC10_2252 2e-08

1
gi|288554775|BpOF4_08800 2.2e-08

1
gi|297582837|Bsel_0515|Y 2.2e-08

1
gi|56419781|GK1246|YP_14 2.5e-08

1
gi|261419446|GYMC61_2030 2.5e-08

1
gi|52080075|BL02968|YP_0 2.5e-08

1
gi|52785449|BLi01689|YP_ 2.5e-08

1
gi|218848158|BCG9842_003 2.5e-08

1
gi|297530579|GC56T3_2307 2.5e-08

1
gi|49185294|BAS2285|YP_0 2.8e-08

1
gi|227814737|BAMEG_2147| 2.8e-08

1
gi|30020517|BC2386|NP_83 2.8e-08

1
gi|30262453|BA2454|NP_84 2.8e-08

1
gi|47527745|GBAA2454|YP_ 2.8e-08

1
gi|52143032|BCZK2206|YP_ 2.8e-08

1
gi|49477707|BT9727_2248| 2.8e-08

1
gi|217959947|BCAH187_A25 2.8e-08

1
gi|118477845|BALH_2188|Y 2.8e-08

1
gi|218233483|BCB4264_A24 2.8e-08

1
gi|225864413|BCA_2518|YP 2.8e-08

1
gi|218903588|BCAH820_247 2.8e-08

1
gi|222096033|BCQ_2373|YP 2.8e-08

1
gi|229601988|BAA_2511|YP 2.8e-08

1
gi|261405039|GYMC10_1184 2.8e-08

1
gi|16080921|BSU38700|NP_ 2.8e-08

1
gi|296502978|BMB171_C214 2.8e-08

1
gi|301053967|BACI_c23980 2.8e-08

1
gi|16078537|BSU14730|NP_ 3e-08

1
gi|172056208|Exig_0164|Y 3e-08

1
gi|15615785|BH3223|NP_24 3e-08

1
gi|23098753|OB1298|NP_69 3.5e-08

1
gi|261406442|GYMC10_2604 3.5e-08

1
gi|297582696|Bsel_0370|Y 3.5e-08

1
gi|229917220|EAT1b_1495| 3.5e-08

1
gi|212639788|Aflv_1962|Y 3.8e-08

1
gi|239827399|GWCH70_2031 3.8e-08

1
gi|297584063|Bsel_1770|Y 4.1e-08

1
gi|157694260|BPUM_3514|Y 4.1e-08

1
gi|49184672|BAS1658|YP_0 4.4e-08

1
gi|163939640|BcerKBAB4_1 4.4e-08

1
gi|222095458|BCQ_1798|YP 4.4e-08

1
gi|42780931|BCE_1861|NP_ 4.4e-08

1
gi|217959319|BCAH187_A19 4.4e-08

1
gi|47527079|GBAA1789|YP_ 4.4e-08

1
gi|225863696|BCA_1798|YP 4.4e-08

1
gi|30261838|BA1789|NP_84 4.4e-08

1
gi|218902955|BCAH820_183 4.4e-08

1
gi|49481088|BT9727_1636| 4.4e-08

1
gi|218896772|BCG9842_B35 4.4e-08

1
gi|227815388|BAMEG_2801| 4.4e-08

1
gi|118477262|BALH_1573|Y 4.4e-08

1
gi|229602836|BAA_1861|YP 4.4e-08

1
gi|52143630|BCZK1605|YP_ 4.4e-08

1
gi|301053373|BACI_c17850 4.4e-08

1
gi|295696140|Btus_1522|Y 4.4e-08

1
gi|295694973|Btus_0293|Y 4.8e-08

1
gi|163942349|BcerKBAB4_4 5.6e-08

1
gi|138894925|GTNG_1263|Y 5.6e-08

1
gi|261407955|GYMC10_4162 6.1e-08

1
gi|295696987|Btus_2417|Y 6.5e-08

1
gi|218905848|BCAH820_473 7.1e-08

1
gi|217962100|BCAH187_A47 7.1e-08

1
gi|49478708|BT9727_4352| 7.1e-08

1
gi|222098082|BCQ_4424|YP 7.1e-08

1
gi|225866598|BCA_4732|YP 7.1e-08

1
gi|118479762|BALH_4199|Y 7.1e-08

1
gi|294500913|BMQ_4167|YP 7.1e-08

1
gi|295706259|BMD_4154|YP 7.1e-08

1
gi|295705020|BMD_2904|YP 7.1e-08

1
gi|294499631|BMQ_2875|YP 7.1e-08

1
gi|169827296|Bsph_1728|Y 7.6e-08

1
gi|169826467|Bsph_0879|Y 9.5e-08

1
gi|23100228|OB2773|NP_69 9.5e-08

1
gi|295695225|Btus_0554|Y 1.1e-07

1
gi|261409914|GYMC10_6143 1.1e-07

1
gi|295705907|BMD_3799|YP 1.3e-07

1
gi|294500554|BMQ_3807|YP 1.3e-07

1
gi|239826640|GWCH70_1138 1.3e-07

1
gi|172058539|Exig_2532|Y 1.4e-07

1
gi|297582728|Bsel_0402|Y 1.6e-07

1
gi|23099037|OB1582|NP_69 1.8e-07

1
gi|56965809|ABC4051|YP_1 1.8e-07

1
gi|157694452|BPUM_3710|Y 2.1e-07

1
gi|261405575|GYMC10_1726 2.1e-07

1
gi|261409324|GYMC10_5549 2.1e-07

1
gi|297582431|Bsel_0096|Y 2.4e-07

1
gi|56421959|GK3424|YP_14 2.6e-07

1
gi|261420836|GYMC61_3488 2.6e-07

1
gi|42780194|BCE_1118|NP_ 2.6e-07

1
gi|261404205|GYMC10_0333 2.6e-07

1
gi|297531625|GC56T3_3410 2.6e-07

1
gi|169826213|Bsph_0618|Y 2.6e-07

1
gi|138897001|GTNG_3372|Y 2.8e-07

1
gi|47530207|GBAA4913|YP_ 3e-07

1
gi|222098134|BCQ_4476|YP 3e-07

1
gi|218233191|BCB4264_A47 3e-07

1
gi|30264734|BA4913|NP_84 3e-07

1
gi|42783844|BCE_4798|NP_ 3e-07

1
gi|217962148|BCAH187_A47 3e-07

1
gi|227817453|BAMEG_4945| 3e-07

1
gi|52140841|BCZK4409|YP_ 3e-07

1
gi|218905890|BCAH820_477 3e-07

1
gi|229604251|BAA_4924|YP 3e-07

1
gi|49187552|BAS4558|YP_0 3e-07

1
gi|118479803|BALH_4240|Y 3e-07

1
gi|301056170|BACI_c46590 3e-07

1
gi|49478801|BT9727_4602| 3.4e-07

1
gi|163942610|BcerKBAB4_4 3.4e-07

1
gi|295694956|Btus_0276|Y 3.4e-07

1
gi|229917493|EAT1b_1768| 3.4e-07

1
gi|169827905|Bsph_2380|Y 3.7e-07

1
gi|229916805|EAT1b_1078| 3.9e-07

1
gi|169828654|Bsph_3171|Y 3.9e-07

1
gi|261407440|GYMC10_3639 4.2e-07

1
gi|163940540|BcerKBAB4_2 4.8e-07

1
gi|261409306|GYMC10_5531 4.8e-07

1
gi|261404261|GYMC10_0389 5.1e-07

1
gi|169829956|Bsph_4538|Y 5.1e-07

1
gi|163943299|BcerKBAB4_5 5.8e-07

1
gi|152975676|Bcer98_1911 5.8e-07

1
gi|212639538|Aflv_1712|Y 5.8e-07

1
gi|261404314|GYMC10_0444 6.2e-07

1
gi|15613183|BH0620|NP_24 6.7e-07

1
gi|288555440|BpOF4_12150 7.6e-07

1
gi|294500314|BMQ_3558|YP 7.6e-07

1
gi|295705661|BMD_3546|YP 7.6e-07

1
gi|16079766|BSU27120|NP_ 1e-06

1
gi|154685119|RBAM_006640 1e-06

1
gi|52079036|BL05045|YP_0 1.1e-06

1
gi|52784408|BLi00595|YP_ 1.1e-06

1
gi|218900006|BCG9842_B02 1.4e-06

1
gi|23098703|OB1248|NP_69 1.5e-06

1
gi|169829522|Bsph_4082|Y 2.2e-06

1
gi|295705993|BMD_3885|YP 2.5e-06

1
gi|261404792|GYMC10_0928 2.6e-06

1
gi|239826131|GWCH70_0591 3.5e-06

1
gi|163940227|BcerKBAB4_2 4.1e-06

1
gi|288554248|BpOF4_06145 6.5e-06

1
gi|15615778|BH3216|NP_24 8.1e-06

1
gi|163939522|BcerKBAB4_1 1e-05

1
gi|218234226|BCB4264_A16 1e-05

1
gi|23099768|OB2313|NP_69 1.2e-05

1
gi|169826679|Bsph_1097|Y 1.4e-05

1
gi|169829980|Bsph_4562|Y 4e-05

1
gi|15616444|BH3882|NP_24 5e-05

1
gi|15614589|BH2026|NP_24 0.00016

1
gi|49479940|BT9727_1587| 0.0011

1
gi|163940708|BcerKBAB4_2 0.0017

1
gi|16079737|BSU26840|NP_ 0.0024

1
SCALE
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | |
1 25 50 75 100 125 150 175 200 225 250 275 300 325 350 375 400 425 450 475 500 525 550 575 600 625 650 675 700 725 750 775 800

Motif 1 in BLOCKS format


to BLOCKS multiple alignment processor.
Motif 1 position-specific scoring matrix


Motif 1 position-specific probability matrix


Motif 1 regular expression

[ED]D[LI][VI]QE[GT]FI[GK]LYK[AS][ILV]




Time 7149.97 secs.


P N
MOTIF 2     width = 13     sites = 298     llr = 7045     E-value = 8.4e-1697

SimplifiedA::1::::1:31:a
pos.-specificC:::::::::::::
probabilityD:6:::2:::1:::
matrixE:::2:::::1:::
F7:::1:1:7::2:
G:::2:5:::::::
H:::::::::::::
I::::1:1::::::
K:::15117:::::
L::3:::1:31:::
M:::::::::::::
N:1:1:11::::::
P::3:::::::1::
Q::::1::::::::
R:::11::::::::
S:2:3:::1:41::
T::::::1:::8::
V::::::3::::::
W:::::::::::::
Y3:3:1:1::::8:
bits 7.3
6.6
5.9
5.1
Information 4.4 
content 3.7     
(34.1 bits)2.9      
2.2          
1.5             
0.7             
0.0
Multilevel FDYSKGVKFSTYA
consensus YPGLAF
sequence L
NAME   START P-VALUE    SITES 
gi|261407775|GYMC10_39811231.91e-16 NMGLIKAVEKFDYSKGFKFSTYATWWIRQAITR
gi|218232261|BCB4264_A441822.30e-15 NMGLIKAVEKFDYRKGFKFSTYATWWIRQAITR
gi|52141207|BCZK4042|YP_1802.30e-15 NMGLIKAVEKFDYRKGFKFSTYATWWIRQAITR
gi|42783418|BCE_4372|NP_1822.30e-15 NMGLIKAVEKFDYRKGFKFSTYATWWIRQAITR
gi|30264362|BA4515|NP_841802.30e-15 NMGLIKAVEKFDYRKGFKFSTYATWWIRQAITR
gi|222097738|BCQ_4079|YP1822.30e-15 NMGLIKAGEKFDYRKGFKFSTYATWWIRQAITR
gi|218899458|BCG9842_B081822.30e-15 NMGLIKAVEKFDYRKGFKFSTYATWWIRQAITR
gi|218905429|BCAH820_4311802.30e-15 NMGLIKAVEKFDYRKGFKFSTYATWWIRQAITR
gi|229601154|BAA_4536|YP1802.30e-15 NMGLIKAVEKFDYRKGFKFSTYATWWIRQAITR
gi|30022370|BC4289|NP_831822.30e-15 NMGLIKAVEKFDYRKGFKFSTYATWWIRQAITR
gi|152976724|Bcer98_30191802.30e-15 NMGLIKAVEKFDYRKGFKFSTYATWWIRQAITR
gi|163942050|BcerKBAB4_41822.30e-15 NMGLIKAVEKFDYRKGFKFSTYATWWIRQAITR
gi|118479464|BALH_3885|Y1802.30e-15 NMGLIKAVEKFDYRKGFKFSTYATWWIRQAITR
gi|217961783|BCAH187_A441822.30e-15 NMGLIKAVEKFDYRKGFKFSTYATWWIRQAITR
gi|47529811|GBAA4515|YP_1802.30e-15 NMGLIKAVEKFDYRKGFKFSTYATWWIRQAITR
gi|49187190|BAS4194|YP_01802.30e-15 NMGLIKAVEKFDYRKGFKFSTYATWWIRQAITR
gi|225866273|BCA_4403|YP1802.30e-15 NMGLIKAVEKFDYRKGFKFSTYATWWIRQAITR
gi|227817068|BAMEG_4554|1802.30e-15 NMGLIKAVEKFDYRKGFKFSTYATWWIRQAITR
gi|49481307|BT9727_4032|1802.30e-15 NMGLIKAVEKFDYRKGFKFSTYATWWIRQAITR
gi|169829158|Bsph_3702|Y1822.30e-15 NMGLIKAVEKFDYRKGFKFSTYATWWIRQAITR
gi|301055785|BACI_c426201822.30e-15 NMGLIKAVEKFDYRKGFKFSTYATWWIRQAITR
gi|23099399|OB1944|NP_691872.30e-15 NMGLIKAVEKFDYRKGFKFSTYATWWIRQAITR
gi|296504786|BMB171_C3951822.30e-15 NMGLIKAVEKFDYRKGFKFSTYATWWIRQAITR
gi|297584635|Bsel_2346|Y1783.67e-15 NMGLIKAVEKFDYNKGFKFSTYATWWIRQAITR
gi|15613939|BH1376|NP_241793.67e-15 NMGLIKAVEKFDYNKGFKFSTYATWWIRQAITR
gi|261405623|GYMC10_17741849.16e-15 NMGLIKAVEKFDYKKGFKFSTYATWWIRQAITR
gi|56421017|GK2482|YP_141821.41e-14 NMGLIKAVEKFDYRKGYKFSTYATWWIRQAITR
gi|255767573|BSU25200|NP1781.41e-14 NMGLMKAVEKFDYRKGYKFSTYATWWIRQAITR
gi|212638699|Aflv_0856|Y1791.41e-14 NMGLIKAVEKFDYRKGYKFSTYATWWIRQAITR
gi|295706627|BMD_4528|YP1841.41e-14 NMGLIKAVEKFDYRKGYKFSTYATWWIRQAITR
gi|297529352|GC56T3_10081821.41e-14 NMGLIKAVEKFDYRKGYKFSTYATWWIRQAITR
gi|261417657|GYMC61_01571821.41e-14 NMGLIKAVEKFDYRKGYKFSTYATWWIRQAITR
gi|239827752|GWCH70_24141811.41e-14 NMGLIKAVEKFDYRKGYKFSTYATWWIRQAITR
gi|157693020|BPUM_2253|Y1801.41e-14 NMGLMKAVEKFDYRKGYKFSTYATWWIRQAITR
gi|154686781|RBAM_0235101801.41e-14 NMGLMKAVEKFDYRKGYKFSTYATWWIRQAITR
gi|163119552|BL03682|YP_1801.41e-14 NMGLMKAVEKFDYRKGYKFSTYATWWIRQAITR
gi|52786447|BLi02712|YP_1801.41e-14 NMGLMKAVEKFDYRKGYKFSTYATWWIRQAITR
gi|294501280|BMQ_4542|YP1841.41e-14 NMGLIKAVEKFDYRKGYKFSTYATWWIRQAITR
gi|138896056|GTNG_2419|Y1821.41e-14 NMGLIKAVEKFDYRKGYKFSTYATWWIRQAITR
gi|288555754|BpOF4_137301791.79e-14 NMGLIKAVEKFDYEKGYKFSTYATWWIRQAITR
gi|56963455|ABC1690|YP_11802.16e-14 NMGLIKAVEKFDYDKGFKFSTYATWWIRQAITR
gi|212639646|Aflv_1820|Y823.93e-14 CIGLMKSIDNFDLSQNVKFSTYAVPMIIGEIRR
gi|42782996|BCE_3948|NP_1123.93e-14 CIGLMKSIDNFDLGQNVKFSTYAVPMIIGEIRR
gi|218233406|BCB4264_A40823.93e-14 CIGLMKSIDNFDLGQNVKFSTYAVPMIIGEIRR
gi|227813187|BAMEG_0585|823.93e-14 CIGLMKSIDNFDLGQNVKFSTYAVPMIIGEIRR
gi|163941643|BcerKBAB4_31153.93e-14 CIGLMKSIDNFDLGQNVKFSTYAVPMIIGEIRR
gi|152976264|Bcer98_2552823.93e-14 CIGLMKSIDNFDLSQNVKFSTYAVPMIIGEIRR
gi|49478441|BT9727_3645|1123.93e-14 CIGLMKSIDNFDLGQNVKFSTYAVPMIIGEIRR
gi|30263905|BA4042|NP_84823.93e-14 CIGLMKSIDNFDLGQNVKFSTYAVPMIIGEIRR
gi|217961324|BCAH187_A39823.93e-14 CIGLMKSIDNFDLGQNVKFSTYAVPMIIGEIRR
gi|229602177|BAA_4068|YP823.93e-14 CIGLMKSIDNFDLGQNVKFSTYAVPMIIGEIRR
gi|30021992|BC3903|NP_83823.93e-14 CIGLMKSIDNFDLGQNVKFSTYAVPMIIGEIRR
gi|218905033|BCAH820_391823.93e-14 CIGLMKSIDNFDLGQNVKFSTYAVPMIIGEIRR
gi|225865885|BCA_4007|YP823.93e-14 CIGLMKSIDNFDLGQNVKFSTYAVPMIIGEIRR
gi|47778237|GBAA4042|YP_823.93e-14 CIGLMKSIDNFDLGQNVKFSTYAVPMIIGEIRR
gi|222097349|BCQ_3689|YP1123.93e-14 CIGLMKSIDNFDLGQNVKFSTYAVPMIIGEIRR
gi|49186753|BAS3754|YP_01123.93e-14 CIGLMKSIDNFDLGQNVKFSTYAVPMIIGEIRR
gi|218899057|BCG9842_B12823.93e-14 CIGLMKSIDNFDLGQNVKFSTYAVPMIIGEIRR
gi|52141585|BCZK3662|YP_1123.93e-14 CIGLMKSIDNFDLGQNVKFSTYAVPMIIGEIRR
gi|118479123|BALH_3533|Y1123.93e-14 CIGLMKSIDNFDLGQNVKFSTYAVPMIIGEIRR
gi|301055394|BACI_c385901123.93e-14 CIGLMKSIDNFDLGQNVKFSTYAVPMIIGEIRR
gi|288553150|BpOF4_00620823.93e-14 CIGLMKSIDNFDLSQNVKFSTYAVPMIIGEIRR
gi|295706362|BMD_4257|YP823.93e-14 CIGLMKSIDNFDLSQNVKFSTYAVPMIIGEIRR
gi|56964115|ABC2350|YP_1823.93e-14 CIGLMKSIDNFDLSQNVKFSTYAVPMIIGEIRR
gi|295696452|Btus_1846|Y823.93e-14 CIGLMKAIDNFDLGQNVKFSTYAVPMIIGEIRR
gi|296504397|BMB171_C356823.93e-14 CIGLMKSIDNFDLGQNVKFSTYAVPMIIGEIRR
gi|261405674|GYMC10_1825833.93e-14 CIGLMKAIDNFDLSQNVKFSTYAVPMIIGEIRR
gi|294501013|BMQ_4269|YP823.93e-14 CIGLMKSIDNFDLSQNVKFSTYAVPMIIGEIRR
gi|15615117|BH2554|NP_24823.93e-14 CIGLMKSIDNFDLSQNVKFSTYAVPMIIGEIRR
gi|218905210|BCAH820_409775.77e-14 CIGLLKSVDKFDLSFDVKFSTYAVPMIIGEIQR
gi|217961566|BCAH187_A42775.77e-14 CIGLLKSVDKFDLSFDVKFSTYAVPMIIGEIQR
gi|52141420|BCZK3829|YP_775.77e-14 CIGLLKSVDKFDLSFDVKFSTYAVPMIIGEIQR
gi|42783188|BCE_4142|NP_775.77e-14 CIGLLKSVDKFDLSFDVKFSTYAVPMIIGEIQR
gi|47529588|GBAA4294|YP_775.77e-14 CIGLLKSVDKFDLSFDVKFSTYAVPMIIGEIQR
gi|227816852|BAMEG_4334|775.77e-14 CIGLLKSVDKFDLSFDVKFSTYAVPMIIGEIQR
gi|118479276|BALH_3690|Y775.77e-14 CIGLLKSVDKFDLSFDVKFSTYAVPMIIGEIQR
gi|225866059|BCA_4185|YP775.77e-14 CIGLLKSVDKFDLSFDVKFSTYAVPMIIGEIQR
gi|218899234|BCG9842_B10775.77e-14 CIGLLKSVDKFDLSFDVKFSTYAVPMIIGEIQR
gi|30264150|BA4294|NP_84775.77e-14 CIGLLKSVDKFDLSFDVKFSTYAVPMIIGEIQR
gi|49478518|BT9727_3813|775.77e-14 CIGLLKSVDKFDLSFDVKFSTYAVPMIIGEIQR
gi|218234550|BCB4264_A41775.77e-14 CIGLLKSVDKFDLSFDVKFSTYAVPMIIGEIQR
gi|222097523|BCQ_3863|YP775.77e-14 CIGLLKSVDKFDLSFDVKFSTYAVPMIIGEIQR
gi|49186981|BAS3983|YP_0775.77e-14 CIGLLKSVDKFDLSFDVKFSTYAVPMIIGEIQR
gi|30022159|BC4072|NP_83775.77e-14 CIGLLKSVDKFDLSFDVKFSTYAVPMIIGEIQR
gi|163941815|BcerKBAB4_3775.77e-14 CIGLLKSVDKFDLSFDVKFSTYAVPMIIGEIQR
gi|152976482|Bcer98_2771775.77e-14 CIGLLKSVDKFDLSFDVKFSTYAVPMIIGEIQR
gi|229603990|BAA_4316|YP775.77e-14 CIGLLKSVDKFDLSFDVKFSTYAVPMIIGEIQR
gi|301055569|BACI_c40400775.77e-14 CIGLLKSVDKFDLSFDVKFSTYAVPMIIGEIQR
gi|296504567|BMB171_C373775.77e-14 CIGLLKSVDKFDLSFDVKFSTYAVPMIIGEIQR
gi|172056869|Exig_0832|Y1688.31e-14 NMGLIKAVEKFDYTKGYKFSTYATWWIRQAITR
gi|212638845|Aflv_1004|Y739.85e-14 CIGLMKSVDKFDLSYDVKFSTYAVPMILGEIQR
gi|16078597|BSU15330|NP_839.85e-14 CIGLMKSIDNFDLSHNVKFSTYAVPMIIGEIRR
gi|56420843|GK2308|YP_14759.85e-14 CIGLLKSVDKFDLSYDVKFSTYAVPMIIGEIQR
gi|288555973|BpOF4_14835799.85e-14 CIGLIKSVDKFDLSYDVKFSTYAVPMIIGEIQR
gi|157692844|BPUM_2076|Y779.85e-14 CIGLLKSVDKFDLSYDVKFSTYAVPMIIGEIQR
gi|169827282|Bsph_1714|Y79.85e-14 MKSVDKFDLSYDVKFSTYAVPMIIGEIQR
gi|15614101|BH1538|NP_24779.85e-14 CIGLIKSVDKFDLSYDVKFSTYAVPMIIGEIQR
gi|294501135|BMQ_4391|YP779.85e-14 CIGLLKSVDKFDLSYDVKFSTYAVPMIIGEIQR
gi|52785510|BLi01751|YP_839.85e-14 CIGLMKSIDNFDLSHNVKFSTYAVPMIIGEIRR
gi|295706482|BMD_4377|YP779.85e-14 CIGLLKSVDKFDLSYDVKFSTYAVPMIIGEIQR
gi|56963560|ABC1795|YP_1779.85e-14 CIGLIKSVDKFDLSYDVKFSTYAVPMIIGEIQR
gi|154685949|RBAM_015160839.85e-14 CIGLMKSIDNFDLSHNVKFSTYAVPMIIGEIRR
gi|297529524|GC56T3_1195779.85e-14 CIGLLKSVDKFDLSYDVKFSTYAVPMIIGEIQR
gi|239827600|GWCH70_2250759.85e-14 CIGLLKSVDKFDLSYDVKFSTYAVPMIIGEIQR
gi|138895880|GTNG_2239|Y779.85e-14 CIGLLKSVDKFDLSYDVKFSTYAVPMIIGEIQR
gi|295696440|Btus_1834|Y779.85e-14 CIGLMKAIDKFDLSYDVKFSTYAVPMIIGEIQR
gi|261417856|GYMC61_0374779.85e-14 CIGLLKSVDKFDLSYDVKFSTYAVPMIIGEIQR
gi|23099294|OB1839|NP_69759.85e-14 SIGLIKSIDKFDLSYDVKFSTYAVPMIIGEIQR
gi|261405990|GYMC10_2143769.85e-14 CIGLLKSVDKFDLSYDVKFSTYAVPMIIGEIQR
gi|52080136|BL02256|YP_0839.85e-14 CIGLMKSIDNFDLSHNVKFSTYAVPMIIGEIRR
gi|229916320|EAT1b_0589|1711.96e-13 NMGLIKAVEKFDYMKGFKFSTYATWWIRQAITR
gi|56419663|GK1128|YP_14822.73e-13 CIGLMKSIDNFDLNQNVKFSTYAVPMIIGEIRR
gi|297530705|GC56T3_2445822.73e-13 CIGLMKSIDNFDLNQNVKFSTYAVPMIIGEIRR
gi|239826533|GWCH70_1031822.73e-13 CIGLMKSIDNFDLNQNVKFSTYAVPMIIGEIRR
gi|138894663|GTNG_0993|Y872.73e-13 CIGLMKSIDNFDLNQNVKFSTYAVPMIIGEIRR
gi|261419325|GYMC61_1901822.73e-13 CIGLMKSIDNFDLNQNVKFSTYAVPMIIGEIRR
gi|56421070|GK2535|YP_14943.75e-13 TIGLIKAIESYSPGKGTKLATYAARCIENEILM
gi|261418447|GYMC61_09821023.75e-13 TIGLIKAIESYSPGKGTKLATYAARCIENEILM
gi|239827809|GWCH70_2471943.75e-13 TIGLIKAIESYSPGKGTKLATYAARCIENEILM
gi|297529299|GC56T3_09551023.75e-13 TIGLIKAIESYSPGKGTKLATYAARCIENEILM
gi|295695448|Btus_0783|Y1861.42e-12 NLGLIKAVEKFDFRKGFKFSTYATWWIRQAITR
gi|138896107|GTNG_2470|Y941.86e-12 TIGLIKAIESYSPNKGTKLATYAARCIENEILM
gi|56419781|GK1246|YP_14713.59e-12 LVGLYDALEKFDPSRDLKFDTYASFRIRGAILD
gi|212639538|Aflv_1712|Y613.59e-12 LLGLYDALEKFDPSRDLKFDTYASFRIRGAILD
gi|16078710|BSU16470|NP_703.59e-12 MLGLYDALEKFDPSRDLKFDTYASFRIRGAIID
gi|138894766|GTNG_1100|Y733.59e-12 LVGLYDALEKFDPSRDLKFDTYASFRIRGAILD
gi|261419446|GYMC61_2030713.59e-12 LVGLYDALEKFDPSRDLKFDTYASFRIRGAILD
gi|261405673|GYMC10_18241033.59e-12 AIGLIKAVNTFDPEKKIKLATYASRCIENEILM
gi|154686064|RBAM_016310703.59e-12 MLGLYDALEKFDPGRDLKFDTYASFRIRGAIID
gi|157692327|BPUM_1546|Y703.59e-12 MLGLYDALEKFDPGRDLKFDTYASFRIRGAIID
gi|23099037|OB1582|NP_69713.59e-12 ILGLYDALKKFDPSRDLKFDTYASFRIKGSIMD
gi|52785627|BLi01868|YP_703.59e-12 MLGLYDALEKFDPGRDLKFDTYASFRIRGAIID
gi|52080250|BL01246|YP_0703.59e-12 MLGLYDALEKFDPGRDLKFDTYASFRIRGAIID
gi|297530579|GC56T3_2307713.59e-12 LVGLYDALEKFDPSRDLKFDTYASFRIRGAILD
gi|239826640|GWCH70_1138713.59e-12 LMGLYDALEKFDPSRDLKFDTYASFRIRGAIFD
gi|229603939|BAA_4584|YP934.61e-12 TIGLIKAIESYSAGKGTKLATYAARCIENEILM
gi|49481469|BT9727_4074|934.61e-12 TIGLIKAIESYSAGKGTKLATYAARCIENEILM
gi|49187232|BAS4236|YP_0934.61e-12 TIGLIKAIESYSAGKGTKLATYAARCIENEILM
gi|222097784|BCQ_4125|YP1194.61e-12 TIGLIKAIESYSAGKGTKLATYAARCIENEILM
gi|218905533|BCAH820_441934.61e-12 TIGLIKAIESYSAGKGTKLATYAARCIENEILM
gi|227817116|BAMEG_4602|934.61e-12 TIGLIKAIESYSAGKGTKLATYAARCIENEILM
gi|217961829|BCAH187_A44934.61e-12 TIGLIKAIESYSAGKGTKLATYAARCIENEILM
gi|225866320|BCA_4450|YP934.61e-12 TIGLIKAIESYSAGKGTKLATYAARCIENEILM
gi|163942095|BcerKBAB4_4934.61e-12 TIGLIKAIESYSAGKGTKLATYAARCIENEILM
gi|218231149|BCB4264_A44934.61e-12 TIGLIKAIESYSAGKGTKLATYAARCIENEILM
gi|218899507|BCG9842_B07934.61e-12 TIGLIKAIESYSAGKGTKLATYAARCIENEILM
gi|118479504|BALH_3926|Y1274.61e-12 TIGLIKAIESYSAGKGTKLATYAARCIENEILM
gi|30022417|BC4336|NP_83964.61e-12 TIGLIKAIESYSAGKGTKLATYAARCIENEILM
gi|152976769|Bcer98_3065934.61e-12 TIGLIKAIESYSAGKGTKLATYAARCIENEILM
gi|30264411|BA4566|NP_84934.61e-12 TIGLIKAIESYSAGKGTKLATYAARCIENEILM
gi|42783467|BCE_4421|NP_1214.61e-12 TIGLIKAIESYSAGKGTKLATYAARCIENEILM
gi|52141167|BCZK4084|YP_934.61e-12 TIGLIKAIESYSAGKGTKLATYAARCIENEILM
gi|47529862|GBAA4566|YP_934.61e-12 TIGLIKAIESYSAGKGTKLATYAARCIENEILM
gi|154686834|RBAM_024040944.61e-12 TIGLIKGIESYSAGKGTKLATYAARCIENEILM
gi|157692208|BPUM_1427|Y834.61e-12 CIGLMKSIDNFDLSHNVRFSTYAVPMIIGEIRR
gi|52080862|BL00778|YP_0774.61e-12 CIGLLKSVDKFDLSYDVRFSTYAVPMIIGEIQR
gi|301055830|BACI_c43070374.61e-12 TIGLIKAIESYSAGKGTKLATYAARCIENEILM
gi|23098931|OB1476|NP_69834.61e-12 CIGLMKSIDNFDLSHNVRFSTYAVPMIIGEIRR
gi|52786234|BLi02495|YP_774.61e-12 CIGLLKSVDKFDLSYDVRFSTYAVPMIIGEIQR
gi|52081127|BL02107|YP_0944.61e-12 TIGLIKAIESYSAGKGTKLATYAARCIENEILM
gi|296504831|BMB171_C400524.61e-12 TIGLIKAIESYSAGKGTKLATYAARCIENEILM
gi|52786504|BLi02769|YP_944.61e-12 TIGLIKAIESYSAGKGTKLATYAARCIENEILM
gi|154686587|RBAM_021560774.61e-12 CIGLLKSVDKFDLSYDVRFSTYAVPMIIGEIQR
gi|229918653|EAT1b_2940|675.21e-12 YMGLYDALMKYDPEHNNKFDTYAAFRIRGAIID
gi|294500913|BMQ_4167|YP716.64e-12 LIGLYDALEKFDYGRDLKFDTYASFRIRGAIID
gi|295706259|BMD_4154|YP716.64e-12 LIGLYDALEKFDYGRDLKFDTYASFRIRGAIID
gi|255767354|BSU15320|NP1029.47e-12 TIGLIKAVNTFNPEKKIKLATYASRCIENEILM
gi|227813186|BAMEG_0584|1029.47e-12 TIGLIKAVNTFNPEKKIKLATYASRCIENEILM
gi|152976265|Bcer98_25531029.47e-12 TIGLIKAVNTFNPEKKIKLATYASRCIENEILM
gi|218899058|BCG9842_B121029.47e-12 TIGLIKAVNTFNPEKKIKLATYASRCIENEILM
gi|218905035|BCAH820_3911029.47e-12 TIGLIKAVNTFNPEKKIKLATYASRCIENEILM
gi|30263906|BA4043|NP_841029.47e-12 TIGLIKAVNTFNPEKKIKLATYASRCIENEILM
gi|225865886|BCA_4008|YP1029.47e-12 TIGLIKAVNTFNPEKKIKLATYASRCIENEILM
gi|47529336|GBAA4043|YP_1029.47e-12 TIGLIKAVNTFNPEKKIKLATYASRCIENEILM
gi|212639647|Aflv_1821|Y1029.47e-12 TIGLIKAVNTFNPEKKIKLATYASRCIENEILM
gi|52141583|BCZK3663|YP_1029.47e-12 TIGLIKAVNTFNPEKKIKLATYASRCIENEILM
gi|42782997|BCE_3949|NP_1029.47e-12 TIGLIKAVNTFNPEKKIKLATYASRCIENEILM
gi|217961326|BCAH187_A391029.47e-12 TIGLIKAVNTFNPEKKIKLATYASRCIENEILM
gi|222097350|BCQ_3690|YP1029.47e-12 TIGLIKAVNTFNPEKKIKLATYASRCIENEILM
gi|229601447|BAA_4069|YP1029.47e-12 TIGLIKAVNTFNPEKKIKLATYASRCIENEILM
gi|30021993|BC3904|NP_831029.47e-12 TIGLIKAVNTFNPEKKIKLATYASRCIENEILM
gi|162382776|BALH_3534|Y1029.47e-12 TIGLIKAVNTFNPEKKIKLATYASRCIENEILM
gi|218234749|BCB4264_A401029.47e-12 TIGLIKAVNTFNPEKKIKLATYASRCIENEILM
gi|49186754|BAS3755|YP_01029.47e-12 TIGLIKAVNTFNPEKKIKLATYASRCIENEILM
gi|163941644|BcerKBAB4_31029.47e-12 TIGLIKAVNTFNPEKKIKLATYASRCIENEILM
gi|49478442|BT9727_3646|1029.47e-12 TIGLIKAVNTFNPEKKIKLATYASRCIENEILM
gi|56419662|GK1127|YP_141029.47e-12 TIGLIKAVNTFNPEKKIKLATYASRCIENEILM
gi|294501014|BMQ_4270|YP1029.47e-12 TIGLIKAVNTFNPEKKIKLATYASRCIENEILM
gi|157692207|BPUM_1426|Y1029.47e-12 TIGLIKAVNTFNPEKKIKLATYASRCIENEILM
gi|15615119|BH2556|NP_241009.47e-12 TIGLIKAVNTFNPEKKIKLATYASRCIENEILM
gi|296504398|BMB171_C3561029.47e-12 TIGLIKAVNTFNPEKKIKLATYASRCIENEILM
gi|52785509|BLi01750|YP_1029.47e-12 TIGLIKAVNTFNPEKKIKLATYASRCIENEILM
gi|154685948|RBAM_0151501029.47e-12 TIGLIKAVNTFNPEKKIKLATYASRCIENEILM
gi|52080135|BL02255|YP_01029.47e-12 TIGLIKAVNTFNPEKKIKLATYASRCIENEILM
gi|288553151|BpOF4_006251009.47e-12 TIGLIKAVNTFNPEKKIKLATYASRCIENEILM
gi|138894662|GTNG_0992|Y1029.47e-12 TIGLIKAVNTFNPEKKIKLATYASRCIENEILM
gi|23098930|OB1475|NP_691029.47e-12 TIGLIKAVNTFNPEKKIKLATYASRCIENEILM
gi|239826532|GWCH70_10301029.47e-12 TIGLIKAVNTFNPEKKIKLATYASRCIENEILM
gi|56964116|ABC2351|YP_11009.47e-12 TIGLIKAVNTFNPEKKIKLATYASRCIENEILM
gi|297530706|GC56T3_24461029.47e-12 TIGLIKAVNTFNPEKKIKLATYASRCIENEILM
gi|295706363|BMD_4258|YP1029.47e-12 TIGLIKAVNTFNPEKKIKLATYASRCIENEILM
gi|261419324|GYMC61_19001029.47e-12 TIGLIKAVNTFNPEKKIKLATYASRCIENEILM
gi|301055395|BACI_c386001019.47e-12 TIGLIKAVNTFNPEKKIKLATYASRCIENEILM
gi|212638647|Aflv_0804|Y941.06e-11 TIGLIKAIESYSTGKGTKLATYAARCIENEIFM
gi|15613848|BH1285|NP_24942.30e-11 TIGLIKAIESFSEGKGTKLATYAARCIENEILM
gi|169827020|Bsph_1444|Y812.56e-11 CIGLMKAIDHFDLKHNVRFSTYAVPMIIGEIRR
gi|294501329|BMQ_4591|YP942.85e-11 TIGLIKAIESYSQGKGTKLATYAARCIENEILM
gi|295706676|BMD_4577|YP942.85e-11 TIGLIKAIESYSQGKGTKLATYAARCIENEILM
gi|138897001|GTNG_3372|Y753.16e-11 RLSFLRLLEHYDPNQGTSFESYAMKSLIGYMKN
gi|288553039|BpOF4_00065713.16e-11 MLGLYDALEKFNPNRDLKFDTYASFRVRGAIID
gi|157693076|BPUM_2309|Y1423.16e-11 TIGLIKAIESYSSG