<?xml version='1.0'?>
<!DOCTYPE art SYSTEM 'http://www.biomedcentral.com/xml/article.dtd'>
<art>
   <ui>1745-7580-3-7</ui>
   <ji>1745-7580</ji>
   <fm>
      <dochead>Research</dochead>
      <bibl>
         <title>
            <p><it>In silico </it>characterization of immunogenic epitopes presented by HLA-Cw*0401</p>
         </title>
         <aug>
            <au id="A1">
               <snm>Tong</snm>
               <fnm>Joo Chuan</fnm>
               <insr iid="I1"/>
               <email>jctong@i2r.a-star.edu.sg</email>
            </au>
            <au id="A2">
               <snm>Zhang</snm>
               <fnm>Zong Hong</fnm>
               <insr iid="I1"/>
               <email>zhzhang@i2r.a-star.edu.sg</email>
            </au>
            <au id="A3">
               <snm>August</snm>
               <fnm>J Thomas</fnm>
               <insr iid="I3"/>
               <email>taugust@jhmi.edu</email>
            </au>
            <au id="A4">
               <snm>Brusic</snm>
               <fnm>Vladimir</fnm>
               <insr iid="I4"/>
               <email>Vladimir_Brusic@dfci.harvard.edu</email>
            </au>
            <au id="A5">
               <snm>Tan</snm>
               <fnm>Tin Wee</fnm>
               <insr iid="I2"/>
               <email>tinwee@bic.nus.edu.sg</email>
            </au>
            <au id="A6" ca="yes">
               <snm>Ranganathan</snm>
               <fnm>Shoba</fnm>
               <insr iid="I5"/>
               <insr iid="I2"/>
               <email>shoba.ranganathan@mq.edu.au</email>
            </au>
         </aug>
         <insg>
            <ins id="I1">
               <p>Institute for Infocomm Research, 21 Heng Mui Keng Terrace, 119613, Singapore</p>
            </ins>
            <ins id="I2">
               <p>Department of Biochemistry, Yong Loo Lin School of Medicine, National University of Singapore, 8 Medical Drive, 117597, Singapore</p>
            </ins>
            <ins id="I3">
               <p>Department of Pharmacology and Molecular Sciences, John Hopkins University School of Medicine, Baltimore, MD, USA</p>
            </ins>
            <ins id="I4">
               <p>Cancer Vaccine Center, Dana-Farber Cancer Institute, Boston, MA, USA</p>
            </ins>
            <ins id="I5">
               <p>Department of Chemistry and Biomolecular Sciences &amp; Biotechnology Research Institute, Macquarie University, NSW 2109, Australia</p>
            </ins>
         </insg>
         <source>Immunome Research</source>
         <issn>1745-7580</issn>
         <pubdate>2007</pubdate>
         <volume>3</volume>
         <issue>1</issue>
         <fpage>7</fpage>
         <url>http://www.immunome-research.com/content/3/1/7</url>
         <xrefbib>
            <pubidlist>
               <pubid idtype="pmpid">17705876</pubid>
               <pubid idtype="doi">10.1186/1745-7580-3-7</pubid>
            </pubidlist>
         </xrefbib>
      </bibl>
      <history>
         <rec>
            <date>
               <day>18</day>
               <month>5</month>
               <year>2007</year>
            </date>
         </rec>
         <acc>
            <date>
               <day>20</day>
               <month>8</month>
               <year>2007</year>
            </date>
         </acc>
         <pub>
            <date>
               <day>20</day>
               <month>8</month>
               <year>2007</year>
            </date>
         </pub>
      </history>
      <cpyrt>
         <year>2007</year>
         <collab>Tong et al; licensee BioMed Central Ltd.</collab>
         <note>This is an Open Access article distributed under the terms of the Creative Commons Attribution License (<url>http://creativecommons.org/licenses/by/2.0</url>), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.</note>
      </cpyrt>
      <abs>
         <sec>
            <st>
               <p>Abstract</p>
            </st>
            <sec>
               <st>
                  <p>Background</p>
               </st>
               <p>HLA-C locus products are poorly understood in part due to their low expression at the cell surface. Recent data indicate that these molecules serve as major restriction elements for human immunodeficiency virus type 1 (HIV-1) cytotoxic T lymphocyte (CTL) epitopes. We report here a structure-based technique for the prediction of peptides binding to Cw*0401. The models were rigorously trained, tested and validated using experimentally verified Cw*0401 binding and non-binding peptides obtained from biochemical studies. A new scoring scheme facilitates the identification of immunological hot spots within antigens, based on the sum of predicted binding energies of the top four binders within a window of 30 amino acids.</p>
            </sec>
            <sec>
               <st>
                  <p>Results</p>
               </st>
               <p>High predictivity is achieved when tested on the training (<it>r</it><sup>2 </sup>= 0.88, <it>s </it>= 3.56 kJ/mol, <it>q</it><sup>2 </sup>= 0.84, <it>s</it><sub><it>press </it></sub>= 5.18 kJ/mol) and test (A<sub>ROC </sub>= 0.93) datasets. Characterization of the predicted Cw*0401 binding sequences indicate that amino acids at key anchor positions share common physico-chemical properties which correlate well with existing experimental studies.</p>
            </sec>
            <sec>
               <st>
                  <p>Conclusion</p>
               </st>
               <p>The analysis of predicted Cw*0401-binding peptides showed that anchor residues may not be restrictive and the Cw*0401 binding pockets may possibly accommodate a wide variety of peptides with common physico-chemical properties. The potential Cw*0401-specific T-cell epitope repertoires for HIV-1 p24<sup>gag </sup>and gp160<sup>gag </sup>glycoproteins are well distributed throughout both glycoproteins, with thirteen and nine immunological hot spots for HIV-1 p24<sup>gag </sup>and gp160<sup>gag </sup>glycoproteins respectively. These findings provide new insights into HLA-C peptide selectivity, indicating that pre-selection of candidate HLA-C peptides may occur at the TAP level, prior to peptide loading in the endoplasmic reticulum.</p>
            </sec>
         </sec>
      </abs>
   </fm>
   <bdy>
      <sec>
         <st>
            <p>Background</p>
         </st>
         <p>Major histocompatibility complex (MHC) class I molecules, HLA-A, -B, and -C, are cell surface glycoproteins consisting of a polymorphic heavy &#945; chain non-covalently linked to a light chain, &#946;<sub>2</sub>-microglobulin (&#946;<sub>2</sub>m). HLA-A and -B molecules play critical roles in cell mediated immune responses by binding short antigenic peptide fragments and presenting them on the surface of antigen-presenting cells for recognition by the CD8<sup>+ </sup>cytotoxic T lymphocyte (CTL). Although several HLA-C specificities with CTL epitopes have been reported <abbrgrp><abbr bid="B1">1</abbr><abbr bid="B2">2</abbr></abbrgrp>, much remains unknown with regards to their role in the immune response against viral antigens in part due to their poor expression at the cell surface <abbrgrp><abbr bid="B3">3</abbr><abbr bid="B4">4</abbr></abbrgrp>. Recent research shows that this group of molecules plays a major role in the control of human immunodeficiency virus type 1 (HIV-1) infection <abbrgrp><abbr bid="B5">5</abbr></abbrgrp>. Improved understanding of peptide binding to this group of molecules is important in the study of HIV-1 disease progression, as well as the design of effective HIV peptide vaccines.</p>
         <p>The HLA-C allele, Cw*0401, is of particular interest in the study of HIV-1 disease progression because it is the restriction element for HIV-1 proteins <abbrgrp><abbr bid="B5">5</abbr></abbrgrp>. Two HIV-1 proteins (p24<sup>gag </sup>and gp160<sup>gag</sup>) are currently known to be restricted by Cw*0401 <abbrgrp><abbr bid="B5">5</abbr></abbrgrp>. Cw*0401 is present in approximately 10% of the general population <abbrgrp><abbr bid="B6">6</abbr></abbrgrp>. The allele is expressed intracellularly in amounts comparable with HLA-A and -B molecules, but is poorly expressed at the cell surface <abbrgrp><abbr bid="B7">7</abbr><abbr bid="B8">8</abbr></abbrgrp>. Improved understanding of peptide binding to this molecule is important for elucidating its role in HIV-1 disease progression.</p>
         <p>Computational strategies for prediction of peptide binding to HLA-A and -B molecules are relatively advanced <abbrgrp><abbr bid="B9">9</abbr></abbrgrp>, while sequence-based predictive models for HLA-C molecules have encountered limited success due to the lack of experimental training data <abbrgrp><abbr bid="B10">10</abbr></abbrgrp>. Two matrix-based prediction algorithms for Cw*0401 were reported <abbrgrp><abbr bid="B11">11</abbr><abbr bid="B12">12</abbr></abbrgrp>, but a sequence independent approach is still lacking. To overcome these limitations, we have developed a structure-based predictive technique that integrates the strength of Monte Carlo simulations and homology modeling <abbrgrp><abbr bid="B13">13</abbr><abbr bid="B14">14</abbr><abbr bid="B15">15</abbr></abbrgrp>. This method utilizes a probe or "base fragment" to sample different regions of the receptor binding site, followed by loop closure and refinement of the entire class I peptide. The technique has been successfully applied to analyze peptides binding to a variety of MHC class II alleles <abbrgrp><abbr bid="B14">14</abbr><abbr bid="B15">15</abbr></abbrgrp>. In this work, we now extend our analysis to peptides presented by the class I HLA-C molecule. We investigated the HIV-1 p24<sup>gag </sup>and gp160<sup>gag </sup>peptide binding repertoire of Cw*0401 and illustrate that areas with high concentration of T-cell epitopes or "immunological hot spots" are potentially well distributed throughout both HIV-1 p24<sup>gag </sup>and gp160<sup>gag</sup>. We also show that Cw*0401 can possibly bind antigenic peptides in amounts comparable to both HLA-A and -B molecules. Characterization of predicted Cw*0401 binding sequences reveal that Cw*0401 may bind a large variety of amino acids at anchor positions with common physico-chemical properties which correlate well with existing experimental studies <abbrgrp><abbr bid="B11">11</abbr></abbrgrp>.</p>
      </sec>
      <sec>
         <st>
            <p>Results and discussion</p>
         </st>
         <sec>
            <st>
               <p>Cw*0401 predictive model</p>
            </st>
            <p>High predictivity (<it>r</it><sup>2 </sup>= 0.88, <it>s </it>= 3.56 kJ/mol, q<sup>2 </sup>= 0.84, s<sub>press </sub>= 5.18 kJ/mol) is achieved when tested on the training dataset of 6 Cw*0401 peptide sequences. The Cw*0401 predictive model outperforms the predictive models done by Rognan <it>et al</it>. <abbrgrp><abbr bid="B16">16</abbr></abbrgrp> on training datasets of 5 A*0204 (<it>r</it><sup>2 </sup>= 0.85, <it>s</it><sub><it>press </it></sub>= 2.40 kJ/mol) and 37 2K<sup>k </sup>(<it>r</it><sup>2 </sup>= 0.78, <it>s</it><sub><it>press </it></sub>= 3.16 kJ/mol) peptide sequences and is comparable with our previous DRB1*0402 (r<sup>2 </sup>= 0.90, s = 1.20 kJ/mol, q<sup>2 </sup>= 0.82, s<sub>press </sub>= 1.61 kJ/mol) and DQB1*0503 (r<sup>2 </sup>= 0.95, s = 1.20 kJ/mol, q<sup>2 </sup>= 0.75, s<sub>press </sub>= 2.15 kJ/mol) prediction models on a training set of 8 peptides <abbrgrp><abbr bid="B17">17</abbr></abbrgrp>. The cross-validation coefficient <it>q</it><sup>2 </sup>and the standard error of prediction <it>s</it><sub><it>press </it></sub>are stable, with <it>q</it><sup>2 </sup>= 0.84 and <it>s</it><sub><it>press </it></sub>= 5.18 kJ/mol. This iterative regression procedure validates the internal consistency of the scoring function in the current model, rendering it suitable for predictions on the test dataset obtained from biochemical studies. The predictive performance of our model is further validated using the test dataset of 58 peptides. The external validation results indicate that our Cw*0401 predictive model is suitable for discriminating binding ligands from the background with high accuracy (A<sub>ROC </sub>= 0.93) with sensitivity of 76% (SP = 0.95).</p>
         </sec>
         <sec>
            <st>
               <p>Characterization of Cw*0401 binding peptides</p>
            </st>
            <p>An in-depth analysis was performed to investigate the characteristics of Cw*0401 binding peptides. A panel of 2279 sequences was generated using an overlapping sliding window of size 9 across the entire p24<sup>gag </sup><abbrgrp><abbr bid="B5">5</abbr></abbrgrp> and gp160<sup>gag </sup><abbrgrp><abbr bid="B18">18</abbr></abbrgrp> glycoproteins and modeled into the binding groove of Cw*0401. From these sequences, a total of 877 binding sequences (predicted binders; SE = 76%, SP = 80%) were selected and a systematic analysis was performed to analyze the number of occurrence of individual amino acid residues and physico-chemical properties <abbrgrp><abbr bid="B19">19</abbr></abbrgrp> at each position of Cw*0401 binding peptides.</p>
            <p>Peptide position p2 is characterized by alanine (10%), glycine (13%), leucine (9%), serine (9%). 60% of the predicted residues at this position are hydrophobic in nature, while 93% are neutral. These properties correlate with the physico-chemical properties of existing binding motif (Tyr/Phe) at p2 <abbrgrp><abbr bid="B11">11</abbr></abbrgrp> as well as with the observed conservation in the test data (Table <tblr tid="T1">1</tblr>: Phe &#8211; 58% and Tyr &#8211; 26%). The p3 position shows a strong preference for glycine (11%) and threonine (8%). Existing anchor residues at this position are aspartic acid and histidine, which accounts for 9% of the total position-specific composition in the dataset. The p4 position shares similar characteristics as p3 (glycine: 9%; threonine: 8%), with additional preference for leucine (8%). Similar results were obtained at the p5 position (alanine: 8%; glycine: 9%; leucine: 8%). At p6, characteristic residues include glycine (9%) and leucine (8%). This position is favored by neutral (81%) acyclic (89%), medium/large (77%), and hydrophobic (51%) residues. The physico-chemical properties of these residues are in agreement with Val/Ile/Leu as reported in earlier studies <abbrgrp><abbr bid="B11">11</abbr></abbrgrp> and is comparable with the conservation in the test dataset reported in Table <tblr tid="T1">1</tblr> (Val &#8211; 29%, Ile &#8211; 12%, Leu and Pro &#8211; 10%). Finally, the p9 position was defined by six amino acids, including alanine (8%), glycine (10%), isoleucine (8%), leucine (8%), threonine (9%), and valine (8%). This position is primarily dominated by neutral (90%) and hydrophobic (58%) residues, and agrees with profiles of Leu/Phe as previously reported <abbrgrp><abbr bid="B11">11</abbr></abbrgrp> and is consistent with the conservation in the test dataset reported in Table <tblr tid="T1">1</tblr> (Leu and Phe &#8211; 39%,). Collectively, our data indicates that individual binding pockets may not be highly specific as previously reported <abbrgrp><abbr bid="B11">11</abbr></abbrgrp> but can rather accommodate a wide-range of anchor residues with common physico-chemical properties. We attribute the discrepancies to two possibilities: i) the lack of extensive research on Cw*0401 peptides; and ii) natural peptides carrying these residues may be present in small amount and were thus not detected by experimental studies.</p>
            <tbl id="T1">
               <title>
                  <p>Table 1</p>
               </title>
               <caption>
                  <p>HLA-Cw4 dataset used in this study.</p>
               </caption>
               <tblbdy cols="6">
                  <r>
                     <c ca="left">
                        <p>
                           <b>No.</b>
                        </p>
                     </c>
                     <c ca="left">
                        <p>
                           <b>Category</b>
                        </p>
                     </c>
                     <c ca="left">
                        <p>
                           <b>Source</b>
                        </p>
                     </c>
                     <c ca="left">
                        <p>
                           <b>Peptide</b>
                        </p>
                     </c>
                     <c ca="left">
                        <p>
                           <b>IC<sub>50 </sub>(nM)</b>
                        </p>
                     </c>
                     <c ca="left">
                        <p>
                           <b>Ref.</b>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c cspan="6">
                        <hr/>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>1</p>
                     </c>
                     <c ca="left">
                        <p>Training Set</p>
                     </c>
                     <c ca="left">
                        <p>Cw3 consensus</p>
                     </c>
                     <c ca="left">
                        <p>FAMPNFQTL</p>
                     </c>
                     <c ca="left">
                        <p>651</p>
                     </c>
                     <c ca="left">
                        <p>24</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>2</p>
                     </c>
                     <c ca="left">
                        <p>Training Set</p>
                     </c>
                     <c ca="left">
                        <p>Cw6 consensus</p>
                     </c>
                     <c ca="left">
                        <p>IPFPIVRYL</p>
                     </c>
                     <c ca="left">
                        <p>>30000</p>
                     </c>
                     <c ca="left">
                        <p>24</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>3</p>
                     </c>
                     <c ca="left">
                        <p>Training Set</p>
                     </c>
                     <c ca="left">
                        <p>Cw7 consensus</p>
                     </c>
                     <c ca="left">
                        <p>KYPDFVDAL</p>
                     </c>
                     <c ca="left">
                        <p>2.4</p>
                     </c>
                     <c ca="left">
                        <p>24</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>4</p>
                     </c>
                     <c ca="left">
                        <p>Training Set</p>
                     </c>
                     <c ca="left">
                        <p>Cw4 consensus</p>
                     </c>
                     <c ca="left">
                        <p>QYDDAVYKL</p>
                     </c>
                     <c ca="left">
                        <p>18</p>
                     </c>
                     <c ca="left">
                        <p>24</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>5</p>
                     </c>
                     <c ca="left">
                        <p>Training Set</p>
                     </c>
                     <c ca="left">
                        <p>Histone H3.3</p>
                     </c>
                     <c ca="left">
                        <p>RYRPGTVAL</p>
                     </c>
                     <c ca="left">
                        <p>>30000</p>
                     </c>
                     <c ca="left">
                        <p>24</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>6</p>
                     </c>
                     <c ca="left">
                        <p>Training Set</p>
                     </c>
                     <c ca="left">
                        <p>Unknown Cw6 natural ligand</p>
                     </c>
                     <c ca="left">
                        <p>YQFTGIKKY</p>
                     </c>
                     <c ca="left">
                        <p>>30000</p>
                     </c>
                     <c ca="left">
                        <p>24</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>7</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>Transcripton factor SUPT4H 56&#8211;64</p>
                     </c>
                     <c ca="left">
                        <p>SFDGIIAMM</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>8</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>Transducin-like 3 120&#8211;128</p>
                     </c>
                     <c ca="left">
                        <p>AFDPTSTLL</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>9</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>UBE3B variant 1 742&#8211;750</p>
                     </c>
                     <c ca="left">
                        <p>VFDPALNLF</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>10</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>XP_173235 3&#8211;11</p>
                     </c>
                     <c ca="left">
                        <p>LFDITGQDF</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>11</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>8 59&#8211;67</p>
                     </c>
                     <c ca="left">
                        <p>VYDTNPAKF</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>12</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>Acyl-CoA synthetase 4 82&#8211;90</p>
                     </c>
                     <c ca="left">
                        <p>LFDHAVSKF</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>13</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>Adenosylhomocyteinehydrolase 566&#8211;574</p>
                     </c>
                     <c ca="left">
                        <p>SFDAHLTEL</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>14</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>ART-1 Adenocarcinoma antigen 21&#8211;29</p>
                     </c>
                     <c ca="left">
                        <p>SFDLLPREF</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>15</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>ATP-binding cassette, sub-family F, member 3 500&#8211;508</p>
                     </c>
                     <c ca="left">
                        <p>YYDPKHVIF</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>16</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>Block of proliferation 1 639&#8211;647</p>
                     </c>
                     <c ca="left">
                        <p>SYDSKLVWF</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>17</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>BM-015 144&#8211;152</p>
                     </c>
                     <c ca="left">
                        <p>HFDPEVVQI</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>18</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>CDC45 541&#8211;549</p>
                     </c>
                     <c ca="left">
                        <p>HFDLSVIEL</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>19</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>Cholesterol acyltransferase 72&#8211;80</p>
                     </c>
                     <c ca="left">
                        <p>HFDDFVTNL</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>20</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>Chromosome 20 open reading frame 40 318&#8211;326</p>
                     </c>
                     <c ca="left">
                        <p>FFDNISSEL</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>21</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>Elongation factor 2 265&#8211;273</p>
                     </c>
                     <c ca="left">
                        <p>YFDPANGKF</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>22</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>Epithelial cell transforming oncogene 21&#8211;29</p>
                     </c>
                     <c ca="left">
                        <p>IFDSKVTEI</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>23</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>Ethanolamine kinase EKI1 132&#8211;141</p>
                     </c>
                     <c ca="left">
                        <p>HWDPQEVTL</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>24</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>Eukaryotic translation initiation factor 3, Su 6 interacting protein 478&#8211;486</p>
                     </c>
                     <c ca="left">
                        <p>FLDLTEGEF</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>25</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>Fatty acid synthetase 544&#8211;552</p>
                     </c>
                     <c ca="left">
                        <p>TFDDIVHSF</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>26</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>FK506 binding protein 9 303&#8211;311</p>
                     </c>
                     <c ca="left">
                        <p>VFDIHVIDF</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>27</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>Glutamine:fructose-6-phosphate amidotransferase (GFAT) 345&#8211;353</p>
                     </c>
                     <c ca="left">
                        <p>NFDDYTVNL</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>28</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>Tousled-like kinase 456&#8211;464</p>
                     </c>
                     <c ca="left">
                        <p>AFDLTEQRY</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>29</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>Transcription factor IIE 144&#8211;152</p>
                     </c>
                     <c ca="left">
                        <p>LFDPMTGTF</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>30</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>HSP 70 kDa 1A 179&#8211;205</p>
                     </c>
                     <c ca="left">
                        <p>IFDLGGGTF</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>31</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>HSPC198 19&#8211;27</p>
                     </c>
                     <c ca="left">
                        <p>SYDLFVNSF</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>32</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>HSP J2 156&#8211;164</p>
                     </c>
                     <c ca="left">
                        <p>SFDTGFTSF</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>33</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>Hypothetical protein FLJ00365 80&#8211;88</p>
                     </c>
                     <c ca="left">
                        <p>YFDAIPVTM</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>34</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>Hypothetical protein FLJ11220 373&#8211;381</p>
                     </c>
                     <c ca="left">
                        <p>YLPDFLDYF</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>35</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>Hypothetical protein FLJ20343 415&#8211;423</p>
                     </c>
                     <c ca="left">
                        <p>RFDEAYIYM</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>36</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>Insuline degrading enzyme IDE 150&#8211;158</p>
                     </c>
                     <c ca="left">
                        <p>YFDVSHEHL</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>37</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>Integrin alpha-V (Vitronectin) 224&#8211;232</p>
                     </c>
                     <c ca="left">
                        <p>KYDPNVYSI</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>38</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>KCIP-1 186&#8211;194</p>
                     </c>
                     <c ca="left">
                        <p>AFDEAIAEL</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>39</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>KIAA0461 721&#8211;729</p>
                     </c>
                     <c ca="left">
                        <p>SMDPLPVFL</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>40</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>KIAA1463 444&#8211;452</p>
                     </c>
                     <c ca="left">
                        <p>FYDERIVVV</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>41</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>KIAA1921 350&#8211;358</p>
                     </c>
                     <c ca="left">
                        <p>VYDGKIYTL</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>42</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>Metalloproteinase 10 331&#8211;339</p>
                     </c>
                     <c ca="left">
                        <p>FWPSLPSYL</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>43</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>Methionine-tRNA synthetase 2 (mitochondrial) 58&#8211;66</p>
                     </c>
                     <c ca="left">
                        <p>YYDEKVVKL</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>44</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>Mucin-5B 168&#8211;176</p>
                     </c>
                     <c ca="left">
                        <p>TFDGTSYTF</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>45</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>Myosin phosphatase target subunit 1 37&#8211;45</p>
                     </c>
                     <c ca="left">
                        <p>KFDDGAVFL</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>46</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>Nuclear autoantigenic sperm protein 599&#8211;607</p>
                     </c>
                     <c ca="left">
                        <p>QYDEAVAQF</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>47</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>Nucleoporin NUP358 261&#8211;269</p>
                     </c>
                     <c ca="left">
                        <p>SFDSALQSV</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>48</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>P621 70&#8211;78</p>
                     </c>
                     <c ca="left">
                        <p>VFDKTLAEL</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>49</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>Phosphate carrier precursor 331&#8211;339</p>
                     </c>
                     <c ca="left">
                        <p>IYDSVKVYF</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>50</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>PRO2242 61&#8211;69</p>
                     </c>
                     <c ca="left">
                        <p>YFDPQYFEF</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>51</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>Protein phosphatase 6 102&#8211;110</p>
                     </c>
                     <c ca="left">
                        <p>KWPDRITLL</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>52</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>Putative prostate tumor suppressor 165&#8211;173</p>
                     </c>
                     <c ca="left">
                        <p>TFDLQRIGF</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>53</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>Rac1 168&#8211;176</p>
                     </c>
                     <c ca="left">
                        <p>VFDEAIRAV</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>54</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>RNA Helicase A 697&#8211;705</p>
                     </c>
                     <c ca="left">
                        <p>VFDPVPVGV</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>55</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>Similiar to KIAA1911 80&#8211;88</p>
                     </c>
                     <c ca="left">
                        <p>FWDGKIVLV</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>56</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>Topoisomerase I 241&#8211;249</p>
                     </c>
                     <c ca="left">
                        <p>YYDGKVMKL</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>57</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>Tensin 3 143&#8211;151</p>
                     </c>
                     <c ca="left">
                        <p>FYDDKVSAL</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>10</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>58</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>HIV-1 (BRU) gp120 350&#8211;358</p>
                     </c>
                     <c ca="left">
                        <p>SFNCGGEFF</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>18</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>59</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>HIV-1 (BRU) gag p24 307&#8211;315</p>
                     </c>
                     <c ca="left">
                        <p>QASQEVKNW</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>21</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>60</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>Synthetic peptide</p>
                     </c>
                     <c ca="left">
                        <p>AYDDAVYKL</p>
                     </c>
                     <c ca="left">
                        <p>Binder</p>
                     </c>
                     <c ca="left">
                        <p>25</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>61</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>Cw7 consensus</p>
                     </c>
                     <c ca="left">
                        <p>AYADFVYAY</p>
                     </c>
                     <c ca="left">
                        <p>>30000</p>
                     </c>
                     <c ca="left">
                        <p>24</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>62</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>CKShs2</p>
                     </c>
                     <c ca="left">
                        <p>KYFDEHYEY</p>
                     </c>
                     <c ca="left">
                        <p>>30000</p>
                     </c>
                     <c ca="left">
                        <p>24</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>63</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>Unknown Cw6 natural ligand</p>
                     </c>
                     <c ca="left">
                        <p>YRHDGGNVL</p>
                     </c>
                     <c ca="left">
                        <p>>30000</p>
                     </c>
                     <c ca="left">
                        <p>24</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>64</p>
                     </c>
                     <c ca="left">
                        <p>Test Set</p>
                     </c>
                     <c ca="left">
                        <p>Unknown Cw7 natural ligand</p>
                     </c>
                     <c ca="left">
                        <p>NKADVILKY</p>
                     </c>
                     <c ca="left">
                        <p>>30000</p>
                     </c>
                     <c ca="left">
                        <p>24</p>
                     </c>
                  </r>
               </tblbdy>
            </tbl>
         </sec>
         <sec>
            <st>
               <p>Prediction of p24<sup>gag </sup>and gp160<sup>gag </sup>immunological hot spots</p>
            </st>
            <p>The potential T-cell epitope repertoire (data not shown) and immunological hot spots (Figure <figr fid="F1">1</figr>) for HIV-1 p24<sup>gag </sup>and gp160<sup>gag </sup>are well distributed throughout both glycoproteins. The known p24<sup>gag </sup>epitope (p24 168&#8211;175) and gp160<sup>gag </sup>epitope (gp160 375&#8211;383) were successfully predicted by our model at the threshold of -200 (SE = 76%, SP = 80%) <abbrgrp><abbr bid="B5">5</abbr><abbr bid="B20">20</abbr></abbrgrp>. At this threshold, the number of predicted hot spots for p24<sup>gag </sup>are fourteen (p24 20&#8211;75, 89&#8211;148, 143&#8211;262, 311&#8211;381, 447&#8211;506, 526&#8211;590, 664&#8211;727, 708&#8211;791, 873&#8211;930, 996&#8211;1053, 1054&#8211;1157, 1157&#8211;1316, 1308&#8211;1368, and 1378&#8211;1427), with an estimated FN = 3, and FP = 3 for SE = 0.76 and SP = 0.95 (Figure <figr fid="F1">1</figr> and Table <tblr tid="T2">2</tblr>). For gp160<sup>gag </sup>we predict nine hot spots (gp160 44&#8211;89, 102&#8211;171, 174&#8211;289, 341&#8211;504, 489&#8211;559, 581&#8211;639, 667&#8211;721, 708&#8211;766, and 793&#8211;852), with an estimated FN = 2, FP = 2 for SE = 0.76 and SP = 0.95 (Figure <figr fid="F1">1</figr> and Table <tblr tid="T3">3</tblr>). The results presented here indicate that Cw*0401 can bind antigenic peptides with specificities comparable to HLA-A and -B molecules, and any variability in antigen expression may be directly related to the loss or reduced cell surface expression of the molecule by mechanisms as yet unknown <abbrgrp><abbr bid="B8">8</abbr><abbr bid="B21">21</abbr></abbrgrp>.</p>
            <tbl id="T2">
               <title>
                  <p>Table 2</p>
               </title>
               <caption>
                  <p>Predicted Cw*0401-specific immunological hotspots for p24<sup>gag</sup>.</p>
               </caption>
               <tblbdy cols="3">
                  <r>
                     <c ca="left">
                        <p>No.</p>
                     </c>
                     <c ca="left">
                        <p>Position</p>
                     </c>
                     <c ca="left">
                        <p>Sequence</p>
                     </c>
                  </r>
                  <r>
                     <c cspan="3">
                        <hr/>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>1</p>
                     </c>
                     <c ca="left">
                        <p>20&#8211;75</p>
                     </c>
                     <c ca="left">
                        <p>RLRPGGKKKYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSE</p>
                        <p>EL</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>2</p>
                     </c>
                     <c ca="left">
                        <p>89&#8211;148</p>
                     </c>
                     <c ca="left">
                        <p>YNTVATLYCVHQRIEIKDTKEALDKIEEEQNKSKKKAQQAAADTGHSNQVSQNY</p>
                        <p>PIVQNIQGQMVHQAIS</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>3</p>
                     </c>
                     <c ca="left">
                        <p>143&#8211;262</p>
                     </c>
                     <c ca="left">
                        <p>PIVQNIQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNT</p>
                        <p>MLNTVGGHQAAMQMLKETINEEAAEWDRVHPVHAGPIAPGQMREPRGSDIAGTT</p>
                        <p>STLQEQIGWMTNNPPIPVGEIY</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>4</p>
                     </c>
                     <c ca="left">
                        <p>311&#8211;381</p>
                     </c>
                     <c ca="left">
                        <p>QEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQGVGGPGHKARVLA</p>
                        <p>EAMSQVTNSATIMMQRG</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>5</p>
                     </c>
                     <c ca="left">
                        <p>447&#8211;506</p>
                     </c>
                     <c ca="left">
                        <p>EFSSEQTRANSPTRRELQVWGRDNNSPSEAGADRQGTVSFNFPQVTLWQRPLVT</p>
                        <p>IKIGGQ</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>6</p>
                     </c>
                     <c ca="left">
                        <p>526&#8211;590</p>
                     </c>
                     <c ca="left">
                        <p>LPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLT</p>
                        <p>QIGCTLNFPIS</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>7</p>
                     </c>
                     <c ca="left">
                        <p>664&#8211;727</p>
                     </c>
                     <c ca="left">
                        <p>FRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAF</p>
                        <p>TIPSINNETP</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>8</p>
                     </c>
                     <c ca="left">
                        <p>708&#8211;791</p>
                     </c>
                     <c ca="left">
                        <p>DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQ</p>
                        <p>NPDIVIYQYMDDLYVGSDLEIGQHRTKIEE</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>9</p>
                     </c>
                     <c ca="left">
                        <p>873&#8211;930</p>
                     </c>
                     <c ca="left">
                        <p>TKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTY</p>
                        <p>QIYQ</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>10</p>
                     </c>
                     <c ca="left">
                        <p>996&#8211;1053</p>
                     </c>
                     <c ca="left">
                        <p>TWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRG</p>
                        <p>RQKV</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>11</p>
                     </c>
                     <c ca="left">
                        <p>1054&#8211;1157</p>
                     </c>
                     <c ca="left">
                        <p>VTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQ</p>
                        <p>IIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVLFLDGIDKAQDE</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>12</p>
                     </c>
                     <c ca="left">
                        <p>1157&#8211;1316</p>
                     </c>
                     <c ca="left">
                        <p>DEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQL</p>
                        <p>DCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDN</p>
                        <p>GSNFTGATVRAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQA</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>13</p>
                     </c>
                     <c ca="left">
                        <p>1308&#8211;1368</p>
                     </c>
                     <c ca="left">
                        <p>IIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQ</p>
                        <p>KQITKIQ</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>14</p>
                     </c>
                     <c ca="left">
                        <p>1378&#8211;1427</p>
                     </c>
                     <c ca="left">
                        <p>RNPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDC</p>
                     </c>
                  </r>
               </tblbdy>
            </tbl>
            <tbl id="T3">
               <title>
                  <p>Table 3</p>
               </title>
               <caption>
                  <p>Predicted Cw*0401-specific immunological hotspots for gp160<sup>gag</sup>.</p>
               </caption>
               <tblbdy cols="3">
                  <r>
                     <c ca="left">
                        <p>No.</p>
                     </c>
                     <c ca="left">
                        <p>Position</p>
                     </c>
                     <c ca="left">
                        <p>Sequence</p>
                     </c>
                  </r>
                  <r>
                     <c cspan="3">
                        <hr/>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>1</p>
                     </c>
                     <c ca="left">
                        <p>44&#8211;89</p>
                     </c>
                     <c ca="left">
                        <p>VWKEATTTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEVVLVNV</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>2</p>
                     </c>
                     <c ca="left">
                        <p>102&#8211;171</p>
                     </c>
                     <c ca="left">
                        <p>EQMHEDIISLWDQSLKPCVKLTPLCVSLKCTDLGNATNTNSSNTNSSSGEMM</p>
                        <p>MEKGEIKNCSFNISTSIR</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>3</p>
                     </c>
                     <c ca="left">
                        <p>174&#8211;289</p>
                     </c>
                     <c ca="left">
                        <p>VQKEYAFFYKLDIIPIDNDTTSYTLTSCNTSVITQACPKVSFEPIPIHYCAP</p>
                        <p>AGFAILKCNNKTFNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVI</p>
                        <p>RSANFTDNAKTI</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>4</p>
                     </c>
                     <c ca="left">
                        <p>341&#8211;504</p>
                     </c>
                     <c ca="left">
                        <p>AKWNATLKQIASKLREQFGNNKTIIFKQSSGGDPEIVTHSFNCGGEFFYCNS</p>
                        <p>TQLFNSTWFNSTWSTEGSNNTEGSDTITLPCRIKQFINMWQEVGKAMYAPPI</p>
                        <p>SGQIRCSSNITGLLLTRDGGNNNNGSEIFRPGGGDMRDNWRSELYKYKVVKI</p>
                        <p>EPLGVAPT</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>5</p>
                     </c>
                     <c ca="left">
                        <p>489&#8211;559</p>
                     </c>
                     <c ca="left">
                        <p>KYKVVKIEPLGVAPTKAKRRVVQREKRAVGIGALFLGFLGAAGSTMGARSMT</p>
                        <p>LTVQARQLLSGIVQQQNN</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>6</p>
                     </c>
                     <c ca="left">
                        <p>581&#8211;639</p>
                     </c>
                     <c ca="left">
                        <p>LQARILAVERYLKDQQLLGIWGCSGKLICTTAVPWNASWSNKSLEQIWNNMT</p>
                        <p>WMEWDRE</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>7</p>
                     </c>
                     <c ca="left">
                        <p>667&#8211;721</p>
                     </c>
                     <c ca="left">
                        <p>ELDKWASLWNWFNITNWLWYIKIFIMIVGGLVGLRIVFAVLSIVNRVRQGYS</p>
                        <p>PLS</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>8</p>
                     </c>
                     <c ca="left">
                        <p>708&#8211;766</p>
                     </c>
                     <c ca="left">
                        <p>SIVNRVRQGYSPLSFQTHLPTPRGPDRPEGIEEEGGERDRDRSIRLVNGSLA</p>
                        <p>LIWDDLR</p>
                     </c>
                  </r>
                  <r>
                     <c ca="left">
                        <p>9</p>
                     </c>
                     <c ca="left">
                        <p>793&#8211;852</p>
                     </c>
                     <c ca="left">
                        <p>RGWEALKYWWNLLQYWSQELKNSAVSLLNATAIAVAEGTDRVIEVVQGACRA</p>
                        <p>IRHIPRRI</p>
                     </c>
                  </r>
               </tblbdy>
            </tbl>
            <fig id="F1">
               <title>
                  <p>Figure 1</p>
               </title>
               <caption>
                  <p>
                     <b>Predicted Cw*0401-specific immunological hotspots for p24<sup>gag </sup>and gp160</b>
                     <b>
                        <sup>gag </sup>
                     </b>
                  </p>
               </caption>
               <text>
                  <p>Predicted start positions of Cw*0401-specific hotspots (sliding window size = 30) along (A) p24<sup>gag </sup>and (B) gp160<sup>gag </sup>glycoproteins. Scores are computed based on the sum of predicted binding energies of top four binders within the 30 amino acid sliding window. Predicted hotspots regions are shown in blue boxes with experimentally verified regions shown in red.</p>
               </text>
               <graphic file="1745-7580-3-7-1"/>
            </fig>
         </sec>
      </sec>
      <sec>
         <st>
            <p>Conclusion</p>
         </st>
         <p>Due to the low expression of HLA-C molecules at the cell surface, their role in cell mediated immune responses remain poorly understood. Collectively, the outcome of this analysis provides insights into the binding specificities of Cw*0401. Our data strongly indicate that Cw*0401 can bind antigenic peptides in amounts comparable to both HLA-A and -B molecules, and show the existence of a potentially large number of Cw*0401-specific T-cell epitopes that are evenly distributed throughout both HIV-1 p24<sup>gag </sup>and gp160<sup>gag </sup>glycoproteins. It remains to be determined what proportion of these peptides may be expressed at the cell surface and capable of eliciting functional responses. Probably, pre-selection of candidate HLA-C peptides may occur at the TAP level, prior to peptide loading in the ER <abbrgrp><abbr bid="B8">8</abbr></abbrgrp>. Consequently, a higher concentration of peptides is necessary for complexation with HLA-C molecules, resulting in their release from TAP. This provides a possible explanation for the reduced cell surface expression of HLA-C molecules <abbrgrp><abbr bid="B8">8</abbr></abbrgrp>.</p>
      </sec>
      <sec>
         <st>
            <p>Methods</p>
         </st>
         <sec>
            <st>
               <p>Data</p>
            </st>
            <sec>
               <st>
                  <p>Crystallographic data</p>
               </st>
               <p>The coordinates of Cw*0401 were obtained from the Protein Databank (PDB) with PDB code 1QQD <abbrgrp><abbr bid="B22">22</abbr></abbrgrp>. The structure was relaxed by conjugate gradient minimization, using the Internal Coordinate Mechanics (ICM) software <abbrgrp><abbr bid="B23">23</abbr></abbrgrp>.</p>
            </sec>
            <sec>
               <st>
                  <p>Experimental binding data</p>
               </st>
               <p>The dataset comprises a total of 64 (57 binders and 7 non-binders) 9-mer peptides (Table <tblr tid="T1">1</tblr>). The available dataset is divided into training and testing datasets. Peptides with experimental IC<sub>50 </sub>values were selected as training data for optimizing the empirical free energy function (refer <it>Empirical Free Energy Function</it>). Due to the lack of experimental data, only 9 peptides with experimental IC<sub>50 </sub>values were identified, six (three binders and three non-binders) of which were used for training, while the remainder (four non-binders) were included in the test dataset as true negatives. Therefore, the training dataset contained six peptides with experimentally determined IC<sub>50 </sub>values (2 high-affinity binders, 1 medium-affinity binder, and 3 non-binders) derived from biochemical studies <abbrgrp><abbr bid="B24">24</abbr></abbrgrp>, while the testing dataset comprised the remainder 58 peptides (54 binders and 4 non-binders) <abbrgrp><abbr bid="B10">10</abbr><abbr bid="B18">18</abbr><abbr bid="B21">21</abbr><abbr bid="B24">24</abbr><abbr bid="B25">25</abbr></abbrgrp>. Experimental IC<sub>50 </sub>values were classified as follows &#8211; high-affinity binders: IC<sub>50 </sub>&#8804; 500 nM, medium-affinity binders: 500 nM &lt; IC<sub>50 </sub>&#8804; 1500 nM, low-affinity binders: 1500 &lt; IC<sub>50 </sub>&#8804; 5000 nM and non-binders: 5000 &lt; IC<sub>50</sub>.</p>
            </sec>
            <sec>
               <st>
                  <p>HIV-1 sequence data</p>
               </st>
               <p>The sequences of HIV-1 p24<sup>gag </sup>and gp160<sup>gag </sup>glycoproteins were obtained from UniProt <abbrgrp><abbr bid="B26">26</abbr></abbrgrp>. The accession numbers for p24<sup>gag </sup>and gp160<sup>gag </sup>glycoproteins used in this study are P04585 and P03377 respectively.</p>
            </sec>
         </sec>
         <sec>
            <st>
               <p>Model</p>
            </st>
            <sec>
               <st>
                  <p>Peptide docking</p>
               </st>
               <p>Docking was performed according to the procedure utilized in previous similar works <abbrgrp><abbr bid="B13">13</abbr><abbr bid="B14">14</abbr><abbr bid="B15">15</abbr></abbrgrp>: (i) pseudo-Brownian rigid body docking of peptide fragments to the ends of the binding groove, (ii) central loop closure by satisfaction of spatial constraints, and (iii) refinement of the backbone and side-chain atoms of the ligand and receptor contact regions.</p>
            </sec>
            <sec>
               <st>
                  <p>Empirical free energy function</p>
               </st>
               <p>The scoring function presented herein is based on the free energy potential in ICM <abbrgrp><abbr bid="B23">23</abbr></abbrgrp>. Computation of the binding free energy was performed according to previous similar work based on the difference between the energy of the solvated complex and the sum of the energy of the solvated receptor and that of the peptide ligand, followed by optimization using experimental IC<sub>50 </sub>values <abbrgrp><abbr bid="B15">15</abbr></abbrgrp>. This step was followed by 6-fold cross-validation for assessment of quality of the scoring function <abbrgrp><abbr bid="B15">15</abbr></abbrgrp>. In <it>k</it>-fold cross-validation, <it>k </it>random, (approximately) equal-sized, disjoint partitions of the sample data were constructed, and all given models were trained on (<it>k</it>-1) partitions and tested on the excluded partition. The results were averaged after <it>k </it>such experiments, and thus the observed error rate may be taken as an estimate of the error rate expected upon generalization to new data. The predictive power of the models was assessed by the cross-validation coefficient <it>q</it><sup>2 </sup>and the standard error of prediction <it>s</it><sub><it>press</it></sub>.</p>
            </sec>
            <sec>
               <st>
                  <p>Immunological hot spot prediction</p>
               </st>
               <p>In this study, 'immunological hot spots' are defined as antigenic regions of up to 30 amino acids and modeled according to previous similar work based on the sum of predicted binding energies of the top four binders within a window of 30 amino acids <abbrgrp><abbr bid="B27">27</abbr></abbrgrp>. Where available, these predicted hotspots were validated with available experimentally determined sites.</p>
            </sec>
         </sec>
         <sec>
            <st>
               <p>Training, testing and validation</p>
            </st>
            <p>The free energy scoring function was calibrated using 6 peptides with experimental IC<sub>50 </sub>values and tested on a dataset 58 peptides (54 binders and 4 non-binders) obtained from biochemical studies (Table <tblr tid="T1">1</tblr>). The predictive performance of our model was assessed using sensitivity (SE), specificity (SP) and receiver operating characteristic (ROC) analysis <abbrgrp><abbr bid="B28">28</abbr></abbrgrp>. SE = TP/(TP+FN) and SP = TN/(TN+FP), indicate percentages of correctly predicted binders and non-binders, respectively. TP (true positives) represents correctly predicted experimental binders and TN (true negatives) for experimental non-binders incorrectly predicted as binders. FN (false negatives) denotes experimental binders predicted as non-binders and FP (false positives) stands for experimental non-binders predicted as binders. The accuracy of our predictions was assessed by the ROC analysis where the ROC curve is generated by plotting SE as a function of (1-SP) for a complete range of classification thresholds. The area under the ROC curve (A<sub>ROC</sub>) provides a measure of overall prediction accuracy, A<sub>ROC </sub>&lt; 70% for poor, A<sub>ROC </sub>> 80% for good and A<sub>ROC </sub>> 90% for excellent predictions <abbrgrp><abbr bid="B15">15</abbr></abbrgrp>.</p>
         </sec>
      </sec>
      <sec>
         <st>
            <p>Abbreviations</p>
         </st>
         <p>CTL, cytotoxic T lymphocyte; HLA, human leukocyte antigen; MHC, major histocompatibility complex; ER, endoplasmic reticulum; HIV, human immunodeficiency virus; ROC, receiver operating characteristic; SE, sensitivity; SP, specificity; TN, true negative; TP, true positive; FN, false negative; FP, false positive</p>
      </sec>
      <sec>
         <st>
            <p>Authors' contributions</p>
         </st>
         <p>JCT carried out the computational modeling studies, participated in data analysis and drafted the manuscript. ZHZ helped in data collection and computational modeling studies. JTA, TWT, VB participated in experimental design. SR conceived the study, and participated in its design and coordination and finalized the manuscript. All authors read and approved the final manuscript.</p>
      </sec>
   </bdy>
   <bm>
      <ack>
         <sec>
            <st>
               <p>Acknowledgements</p>
            </st>
            <p>This work was partly funded by the National Institute of Allergy and Infectious Diseases, National Institute of Health, USA (Grant #5 U19 AI56541 &amp; Contract #HHSN266200400085C).</p>
         </sec>
      </ack>
      <refgrp>
         <bibl id="B1">
            <title>
               <p>Immunological function of HLA-C antigens in HLA-Cw3 transgenic mice</p>
            </title>
            <aug>
               <au>
                  <snm>Dill</snm>
                  <fnm>O</fnm>
               </au>
               <au>
                  <snm>Kievits</snm>
                  <fnm>F</fnm>
               </au>
               <au>
                  <snm>Koch</snm>
                  <fnm>S</fnm>
               </au>
               <au>
                  <snm>Ivanyi</snm>
                  <fnm>P</fnm>
               </au>
               <au>
                  <snm>H&#228;mmerling</snm>
                  <fnm>GJ</fnm>
               </au>
            </aug>
            <source>Proc Natl Acad Sci USA</source>
            <pubdate>1988</pubdate>
            <volume>85</volume>
            <fpage>5664</fpage>
            <lpage>5668</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">281820</pubid>
                  <pubid idtype="pmpid" link="fulltext">2840670</pubid>
                  <pubid idtype="doi">10.1073/pnas.85.15.5664</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B2">
            <title>
               <p>An HLA-C-restricted CD8<sup>+ </sup>cytotoxic T-lymphocyte clone recognizes a highly conserved epitope on human immunodeficiency virus type 1 gag</p>
            </title>
            <aug>
               <au>
                  <snm>Littaua</snm>
                  <fnm>RA</fnm>
               </au>
               <au>
                  <snm>Oldstone</snm>
                  <fnm>MB</fnm>
               </au>
               <au>
                  <snm>Takeda</snm>
                  <fnm>A</fnm>
               </au>
               <au>
                  <snm>Debouck</snm>
                  <fnm>C</fnm>
               </au>
               <au>
                  <snm>Wong</snm>
                  <fnm>JT</fnm>
               </au>
               <etal/>
            </aug>
            <source>J Virol</source>
            <pubdate>1991</pubdate>
            <volume>65</volume>
            <fpage>4051</fpage>
            <lpage>4056</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">248836</pubid>
                  <pubid idtype="pmpid" link="fulltext">1712857</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B3">
            <title>
               <p>Molecular structure of human histocompatibility antigens: the HLA-C series</p>
            </title>
            <aug>
               <au>
                  <snm>Snary</snm>
                  <fnm>D</fnm>
               </au>
               <au>
                  <snm>Barnstable</snm>
                  <fnm>CJ</fnm>
               </au>
               <au>
                  <snm>Bodmer</snm>
                  <fnm>WF</fnm>
               </au>
               <au>
                  <snm>Crumpton</snm>
                  <fnm>MJ</fnm>
               </au>
            </aug>
            <source>Eur J Immunol</source>
            <pubdate>1977</pubdate>
            <volume>8</volume>
            <fpage>580</fpage>
            <lpage>585</lpage>
            <xrefbib>
               <pubid idtype="doi">10.1002/eji.1830070816</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B4">
            <title>
               <p>Low HLA-C expression at cell surfaces correlates with increased turnover of heavy chain mRNA</p>
            </title>
            <aug>
               <au>
                  <snm>McCutcheon</snm>
                  <fnm>JA</fnm>
               </au>
               <au>
                  <snm>Gumperz</snm>
                  <fnm>J</fnm>
               </au>
               <au>
                  <snm>Smith</snm>
                  <fnm>KD</fnm>
               </au>
               <au>
                  <snm>Lutz</snm>
                  <fnm>CT</fnm>
               </au>
               <au>
                  <snm>Parham</snm>
                  <fnm>P</fnm>
               </au>
            </aug>
            <source>J Exp Med</source>
            <pubdate>1995</pubdate>
            <volume>181</volume>
            <fpage>2085</fpage>
            <lpage>2095</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1084/jem.181.6.2085</pubid>
                  <pubid idtype="pmpid">7760000</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B5">
            <title>
               <p>HIV Molecular Immunology 2005</p>
            </title>
            <aug>
               <au>
                  <snm>Korber</snm>
                  <fnm>BTM</fnm>
               </au>
               <au>
                  <snm>Brander</snm>
                  <fnm>C</fnm>
               </au>
               <au>
                  <snm>Haynes</snm>
                  <fnm>BF</fnm>
               </au>
               <au>
                  <snm>Koup</snm>
                  <fnm>R</fnm>
               </au>
               <au>
                  <snm>Moore</snm>
                  <fnm>JP</fnm>
               </au>
               <au>
                  <snm>Walker</snm>
                  <fnm>BD</fnm>
               </au>
               <au>
                  <snm>Watkind</snm>
                  <fnm>DI</fnm>
               </au>
            </aug>
            <publisher>Los Alamos National Laboratory, Theoretical Biology and Biophysics, Los Alamos, New Mexico</publisher>
            <pubdate>2005</pubdate>
         </bibl>
         <bibl id="B6">
            <title>
               <p>High-resolution HLA class I typing in the CEPH families: analysis of linkage disequilibrium among HLA loci</p>
            </title>
            <aug>
               <au>
                  <snm>Bugawan</snm>
                  <fnm>TL</fnm>
               </au>
               <au>
                  <snm>Klitz</snm>
                  <fnm>W</fnm>
               </au>
               <au>
                  <snm>Blair</snm>
                  <fnm>A</fnm>
               </au>
               <au>
                  <snm>Erlich</snm>
                  <fnm>HA</fnm>
               </au>
            </aug>
            <source>Tiss Antigens</source>
            <pubdate>2000</pubdate>
            <volume>56</volume>
            <fpage>392</fpage>
            <lpage>404</lpage>
            <xrefbib>
               <pubid idtype="doi">10.1034/j.1399-0039.2000.560502.x</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B7">
            <title>
               <p>Allele and locus-specific differences in cell surface expression and the association of HLA class I heavy chain with &#946;2-microglobulin: differential effects of inhibition of glycosylation on class I subunit association</p>
            </title>
            <aug>
               <au>
                  <snm>Neefjes</snm>
                  <fnm>JJ</fnm>
               </au>
               <au>
                  <snm>Ploegh</snm>
                  <fnm>HL</fnm>
               </au>
            </aug>
            <source>Eur J Immunol</source>
            <pubdate>1988</pubdate>
            <volume>18</volume>
            <fpage>801</fpage>
            <lpage>810</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1002/eji.1830180522</pubid>
                  <pubid idtype="pmpid">2967765</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B8">
            <title>
               <p>Reduced cell surface expression of HLA-C molecules correlates with restricted peptide binding and stable TAP interaction</p>
            </title>
            <aug>
               <au>
                  <snm>Neisig</snm>
                  <fnm>A</fnm>
               </au>
               <au>
                  <snm>Melief</snm>
                  <fnm>CJ</fnm>
               </au>
               <au>
                  <snm>Neefjes</snm>
                  <fnm>J</fnm>
               </au>
            </aug>
            <source>J Immunol</source>
            <pubdate>1998</pubdate>
            <volume>160</volume>
            <fpage>171</fpage>
            <lpage>179</lpage>
            <xrefbib>
               <pubid idtype="pmpid" link="fulltext">9551969</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B9">
            <title>
               <p>Computational methods for prediction of T-cell epitopes &#8211; a framework for modelling, testing, and applications</p>
            </title>
            <aug>
               <au>
                  <snm>Brusic</snm>
                  <fnm>V</fnm>
               </au>
               <au>
                  <snm>Bajic</snm>
                  <fnm>VB</fnm>
               </au>
               <au>
                  <snm>Petrovsky</snm>
                  <fnm>N</fnm>
               </au>
            </aug>
            <source>Methods</source>
            <pubdate>2004</pubdate>
            <volume>34</volume>
            <fpage>436</fpage>
            <lpage>443</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1016/j.ymeth.2004.06.006</pubid>
                  <pubid idtype="pmpid" link="fulltext">15542369</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B10">
            <title>
               <p>Large-scale analysis of HLA peptides presented by HLA-Cw4</p>
            </title>
            <aug>
               <au>
                  <snm>Buchsbaum</snm>
                  <fnm>S</fnm>
               </au>
               <au>
                  <snm>Barnea</snm>
                  <fnm>E</fnm>
               </au>
               <au>
                  <snm>Dassau</snm>
                  <fnm>L</fnm>
               </au>
               <au>
                  <snm>Beer</snm>
                  <fnm>I</fnm>
               </au>
               <au>
                  <snm>Milner</snm>
                  <fnm>E</fnm>
               </au>
               <au>
                  <snm>Admon</snm>
                  <fnm>A</fnm>
               </au>
            </aug>
            <source>Immunogenetics</source>
            <pubdate>2003</pubdate>
            <volume>55</volume>
            <fpage>172</fpage>
            <lpage>176</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1007/s00251-003-0570-0</pubid>
                  <pubid idtype="pmpid" link="fulltext">12750860</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B11">
            <title>
               <p>SYFPEITHI: database for MHC ligands and peptide motifs</p>
            </title>
            <aug>
               <au>
                  <snm>Rammensee</snm>
                  <fnm>H</fnm>
               </au>
               <au>
                  <snm>Bachmann</snm>
                  <fnm>J</fnm>
               </au>
               <au>
                  <snm>Emmerich</snm>
                  <fnm>NP</fnm>
               </au>
               <au>
                  <snm>Bachor</snm>
                  <fnm>OA</fnm>
               </au>
               <au>
                  <snm>Stevanovic</snm>
                  <fnm>S</fnm>
               </au>
            </aug>
            <source>Immunogenetics</source>
            <pubdate>1999</pubdate>
            <volume>50</volume>
            <fpage>213</fpage>
            <lpage>219</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1007/s002510050595</pubid>
                  <pubid idtype="pmpid" link="fulltext">10602881</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B12">
            <title>
               <p>A modular concept of HLA for comprehensive peptide binding prediction</p>
            </title>
            <aug>
               <au>
                  <snm>DeLuca</snm>
                  <fnm>DS</fnm>
               </au>
               <au>
                  <snm>Khattab</snm>
                  <fnm>B</fnm>
               </au>
               <au>
                  <snm>Blasczyk</snm>
                  <fnm>R</fnm>
               </au>
            </aug>
            <source>Immunogenetics</source>
            <pubdate>2007</pubdate>
            <volume>59</volume>
            <fpage>25</fpage>
            <lpage>35</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1007/s00251-006-0176-4</pubid>
                  <pubid idtype="pmpid" link="fulltext">17119951</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B13">
            <title>
               <p>Modeling the structure of bound peptide ligands to major histocompatibility complex</p>
            </title>
            <aug>
               <au>
                  <snm>Tong</snm>
                  <fnm>JC</fnm>
               </au>
               <au>
                  <snm>Tan</snm>
                  <fnm>TW</fnm>
               </au>
               <au>
                  <snm>Ranganathan</snm>
                  <fnm>S</fnm>
               </au>
            </aug>
            <source>Protein Sci</source>
            <pubdate>2004</pubdate>
            <volume>13</volume>
            <fpage>2523</fpage>
            <lpage>2532</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1110/ps.04631204</pubid>
                  <pubid idtype="pmpid" link="fulltext">15322290</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B14">
            <title>
               <p>Modeling the bound conformation of pemphigus vulgaris-associated peptides to MHC class II DR and DQ alleles</p>
            </title>
            <aug>
               <au>
                  <snm>Tong</snm>
                  <fnm>JC</fnm>
               </au>
               <au>
                  <snm>Bramson</snm>
                  <fnm>J</fnm>
               </au>
               <au>
                  <snm>Kanduc</snm>
                  <fnm>D</fnm>
               </au>
               <au>
                  <snm>Chow</snm>
                  <fnm>S</fnm>
               </au>
               <au>
                  <snm>Sinha</snm>
                  <fnm>AA</fnm>
               </au>
               <au>
                  <snm>Ranganathan</snm>
                  <fnm>S</fnm>
               </au>
            </aug>
            <source>Immunome Res</source>
            <pubdate>2006</pubdate>
            <volume>2</volume>
            <fpage>1</fpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">1395305</pubid>
                  <pubid idtype="pmpid" link="fulltext">16426456</pubid>
                  <pubid idtype="doi">10.1186/1745-7580-2-1</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B15">
            <title>
               <p>Prediction of HLA-DQ3.2<it>&#946; </it>ligands: Evidence of multiple registers in class II binding peptides</p>
            </title>
            <aug>
               <au>
                  <snm>Tong</snm>
                  <fnm>JC</fnm>
               </au>
               <au>
                  <snm>Zhang</snm>
                  <fnm>GL</fnm>
               </au>
               <au>
                  <snm>Tan</snm>
                  <fnm>TW</fnm>
               </au>
               <au>
                  <snm>August</snm>
                  <fnm>JT</fnm>
               </au>
               <au>
                  <snm>Brusic</snm>
                  <fnm>V</fnm>
               </au>
               <au>
                  <snm>Ranganathan</snm>
                  <fnm>S</fnm>
               </au>
            </aug>
            <source>Bioinformatics</source>
            <pubdate>2006</pubdate>
            <volume>22</volume>
            <fpage>1232</fpage>
            <lpage>1238</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1093/bioinformatics/btl071</pubid>
                  <pubid idtype="pmpid" link="fulltext">16510499</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B16">
            <title>
               <p>Predicting binding affinities of protein ligands from three-dimensional models: Application to Peptide Binding to Class I Major Histocompatibility Proteins</p>
            </title>
            <aug>
               <au>
                  <snm>Rognan</snm>
                  <fnm>D</fnm>
               </au>
               <au>
                  <snm>Laum&#248;ller</snm>
                  <fnm>SL</fnm>
               </au>
               <au>
                  <snm>Holm</snm>
                  <fnm>A</fnm>
               </au>
               <au>
                  <snm>Buus</snm>
                  <fnm>S</fnm>
               </au>
               <au>
                  <snm>Tschinke</snm>
                  <fnm>V</fnm>
               </au>
            </aug>
            <source>J Med Chem</source>
            <pubdate>1999</pubdate>
            <volume>42</volume>
            <fpage>4650</fpage>
            <lpage>4658</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1021/jm9910775</pubid>
                  <pubid idtype="pmpid" link="fulltext">10579827</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B17">
            <title>
               <p>Prediction of desmoglein-3 peptides reveals multiple shared T-cell epitopes in HLA DR4- and DR6-associated pemphigus vulgaris</p>
            </title>
            <aug>
               <au>
                  <snm>Tong</snm>
                  <fnm>JC</fnm>
               </au>
               <au>
                  <snm>Bramson</snm>
                  <fnm>J</fnm>
               </au>
               <au>
                  <snm>Kanduc</snm>
                  <fnm>D</fnm>
               </au>
               <au>
                  <snm>Sinha</snm>
                  <fnm>AA</fnm>
               </au>
               <au>
                  <snm>Ranganathan</snm>
                  <fnm>S</fnm>
               </au>
            </aug>
            <source>BMC Bioinformatics</source>
            <pubdate>2006</pubdate>
            <volume>7</volume>
            <issue>Suppl 5</issue>
            <fpage>S7</fpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">1764484</pubid>
                  <pubid idtype="pmpid" link="fulltext">17254312</pubid>
                  <pubid idtype="doi">10.1186/1471-2105-7-S5-S7</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B18">
            <title>
               <p>Recognition of a highly conserved region of human immunodeficiency virus type 1 gp120 by an HLA-Cw4-restricted cytotoxic T-lymphocyte clone</p>
            </title>
            <aug>
               <au>
                  <snm>Johnson</snm>
                  <fnm>RP</fnm>
               </au>
               <au>
                  <snm>Trocha</snm>
                  <fnm>A</fnm>
               </au>
               <au>
                  <snm>Buchanan</snm>
                  <fnm>TM</fnm>
               </au>
               <au>
                  <snm>Walker</snm>
                  <fnm>BD</fnm>
               </au>
            </aug>
            <source>J Virol</source>
            <pubdate>1993</pubdate>
            <volume>67</volume>
            <fpage>438</fpage>
            <lpage>445</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">237380</pubid>
                  <pubid idtype="pmpid" link="fulltext">7677956</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B19">
            <title>
               <p>RASMOL: biomolecular graphics for all</p>
            </title>
            <aug>
               <au>
                  <snm>Sayle</snm>
                  <fnm>RA</fnm>
               </au>
               <au>
                  <snm>Milner-White</snm>
                  <fnm>EJ</fnm>
               </au>
            </aug>
            <source>Trends Biochem Sci</source>
            <pubdate>1995</pubdate>
            <volume>20</volume>
            <fpage>374</fpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1016/S0968-0004(00)89080-5</pubid>
                  <pubid idtype="pmpid" link="fulltext">7482707</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B20">
            <title>
               <p>Recent advances in HIV-1 CTL epitope characterization. In HIV molecular immunology database</p>
            </title>
            <aug>
               <au>
                  <snm>Brander</snm>
                  <fnm>C</fnm>
               </au>
               <au>
                  <snm>Goulder</snm>
                  <fnm>PJR</fnm>
               </au>
            </aug>
            <source>HIV Molecular Database</source>
            <publisher>Los Alamos National Laboratory. Los Alamos, New Mexico</publisher>
            <editor>Korber BTM, Brander C, Haynes BF, Koup R, Moore JP, Walker BD, Watkind DI</editor>
            <pubdate>1999</pubdate>
            <fpage>i1</fpage>
            <lpage>i19</lpage>
         </bibl>
         <bibl id="B21">
            <title>
               <p>Characterization of an HIV-1 p24gag epitope recognized by a CD8+ cytotoxic T-cell clone</p>
            </title>
            <aug>
               <au>
                  <snm>Buseyne</snm>
                  <fnm>F</fnm>
               </au>
               <au>
                  <snm>Stevanovic</snm>
                  <fnm>S</fnm>
               </au>
               <au>
                  <snm>Rammensee</snm>
                  <fnm>HG</fnm>
               </au>
               <au>
                  <snm>Riviere</snm>
                  <fnm>Y</fnm>
               </au>
            </aug>
            <source>Immunol Letters</source>
            <pubdate>1997</pubdate>
            <volume>55</volume>
            <fpage>145</fpage>
            <lpage>149</lpage>
            <xrefbib>
               <pubid idtype="doi">10.1016/S0165-2478(97)02696-5</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B22">
            <title>
               <p>Structure of Hla-Cw4, a Ligand for the Kir2D Natural Killer Cell Inhibitory Receptor</p>
            </title>
            <aug>
               <au>
                  <snm>Fan</snm>
                  <fnm>QR</fnm>
               </au>
               <au>
                  <snm>Wiley</snm>
                  <fnm>DC</fnm>
               </au>
            </aug>
            <source>J Exp Med</source>
            <pubdate>1999</pubdate>
            <volume>190</volume>
            <fpage>113</fpage>
            <lpage>124</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1084/jem.190.1.113</pubid>
                  <pubid idtype="pmpid" link="fulltext">10429675</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B23">
            <title>
               <p>Ab initio folding of peptides by the optimal-bias Monte Carlo minimization procedure</p>
            </title>
            <aug>
               <au>
                  <snm>Abagyan</snm>
                  <fnm>RA</fnm>
               </au>
               <au>
                  <snm>Totrov</snm>
                  <fnm>M</fnm>
               </au>
            </aug>
            <source>J Comput Phys</source>
            <pubdate>1999</pubdate>
            <volume>151</volume>
            <fpage>402</fpage>
            <lpage>421</lpage>
            <xrefbib>
               <pubid idtype="doi">10.1006/jcph.1999.6233</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B24">
            <title>
               <p>Several HLA alleles share overlapping peptide specificities</p>
            </title>
            <aug>
               <au>
                  <snm>Sidney</snm>
                  <fnm>J</fnm>
               </au>
               <au>
                  <snm>del Guercio</snm>
                  <fnm>MF</fnm>
               </au>
               <au>
                  <snm>Southwood</snm>
                  <fnm>S</fnm>
               </au>
               <au>
                  <snm>Engelhard</snm>
                  <fnm>VH</fnm>
               </au>
               <au>
                  <snm>Appella</snm>
                  <fnm>E</fnm>
               </au>
               <au>
                  <snm>Rammensee</snm>
                  <fnm>HG</fnm>
               </au>
               <au>
                  <snm>Falk</snm>
                  <fnm>K</fnm>
               </au>
               <au>
                  <snm>R&#246;tzschke</snm>
                  <fnm>O</fnm>
               </au>
               <au>
                  <snm>Takiguchi</snm>
                  <fnm>M</fnm>
               </au>
               <au>
                  <snm>Kubo</snm>
                  <fnm>RT</fnm>
               </au>
               <au>
                  <snm>Grey</snm>
                  <fnm>HM</fnm>
               </au>
               <au>
                  <snm>Sette</snm>
                  <fnm>A</fnm>
               </au>
            </aug>
            <source>J Immunol</source>
            <pubdate>1995</pubdate>
            <volume>154</volume>
            <fpage>247</fpage>
            <lpage>259</lpage>
            <xrefbib>
               <pubid idtype="pmpid" link="fulltext">7527812</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B25">
            <title>
               <p>The direct binding of a p58 killer cell inhibitory receptor to human histocompatibility leukocyte antigen (HLA)-Cw4 exhibits peptide selectivity</p>
            </title>
            <aug>
               <au>
                  <snm>Rajagopalan</snm>
                  <fnm>S</fnm>
               </au>
               <au>
                  <snm>Long</snm>
                  <fnm>EO</fnm>
               </au>
            </aug>
            <source>J Exp Med</source>
            <pubdate>1997</pubdate>
            <volume>185</volume>
            <fpage>1523</fpage>
            <lpage>1528</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1084/jem.185.8.1523</pubid>
                  <pubid idtype="pmpid" link="fulltext">9126935</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B26">
            <title>
               <p>The Universal Protein Resource (UniProt)</p>
            </title>
            <aug>
               <au>
                  <cnm>The UniProt Consortium</cnm>
               </au>
            </aug>
            <source>Nucleic Acids Res</source>
            <pubdate>2007</pubdate>
            <volume>35</volume>
            <fpage>D193</fpage>
            <lpage>D197</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">1669721</pubid>
                  <pubid idtype="pmpid" link="fulltext">17142230</pubid>
                  <pubid idtype="doi">10.1093/nar/gkl929</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B27">
            <title>
               <p>Prediction of class I T-cell epitopes: evidence of presence of immunological hot spots inside antigens</p>
            </title>
            <aug>
               <au>
                  <snm>Srinivasan</snm>
                  <fnm>KN</fnm>
               </au>
               <au>
                  <snm>Zhang</snm>
                  <fnm>GL</fnm>
               </au>
               <au>
                  <snm>Khan</snm>
                  <fnm>AM</fnm>
               </au>
               <au>
                  <snm>August</snm>
                  <fnm>JT</fnm>
               </au>
               <au>
                  <snm>Brusic</snm>
                  <fnm>V</fnm>
               </au>
            </aug>
            <source>Bioinformatics</source>
            <pubdate>2004</pubdate>
            <volume>20</volume>
            <fpage>i297</fpage>
            <lpage>i302</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1093/bioinformatics/bth943</pubid>
                  <pubid idtype="pmpid" link="fulltext">15262812</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B28">
            <title>
               <p>The use of the area under the ROC curve in the evaluation of machine learning algorithms</p>
            </title>
            <aug>
               <au>
                  <snm>Bradley</snm>
                  <fnm>AP</fnm>
               </au>
            </aug>
            <source>Pattern Recognition</source>
            <pubdate>1997</pubdate>
            <volume>30</volume>
            <fpage>1145</fpage>
            <lpage>1159</lpage>
            <xrefbib>
               <pubid idtype="doi">10.1016/S0031-3203(96)00142-2</pubid>
            </xrefbib>
         </bibl>
      </refgrp>
   </bm>
</art>
