<?xml version='1.0'?>
<!DOCTYPE art SYSTEM 'http://www.biomedcentral.com/xml/article.dtd'>
<art>
   <ui>1471-2148-8-259</ui>
   <ji>1471-2148</ji>
   <fm>
      <dochead>Research article</dochead>
      <bibl>
         <title>
            <p>Structural and functional divergence of two fish aquaporin-1 water channels following teleost-specific gene duplication</p>
         </title>
         <aug>
            <au id="A1">
               <snm>Tingaud-Sequeira</snm>
               <fnm>Ang&#232;le</fnm>
               <insr iid="I1"/>
               <insr iid="I3"/>
               <email>angela.tingaud@u-bordeaux1.fr</email>
            </au>
            <au id="A2">
               <snm>Chauvign&#233;</snm>
               <fnm>Fran&#231;ois</fnm>
               <insr iid="I1"/>
               <email>chauvigne@cmima.csic.es</email>
            </au>
            <au id="A3">
               <snm>Fabra</snm>
               <fnm>Mercedes</fnm>
               <insr iid="I1"/>
               <insr iid="I4"/>
               <email>merchefabra@hotmail.com</email>
            </au>
            <au id="A4">
               <snm>Lozano</snm>
               <fnm>Juanjo</fnm>
               <insr iid="I2"/>
               <email>juanjo.lozano@ciberehd.org</email>
            </au>
            <au id="A5">
               <snm>Rald&#250;a</snm>
               <fnm>Demetrio</fnm>
               <insr iid="I1"/>
               <insr iid="I5"/>
               <email>raldua@intexter.upc.edu</email>
            </au>
            <au ca="yes" id="A6">
               <snm>Cerd&#224;</snm>
               <fnm>Joan</fnm>
               <insr iid="I1"/>
               <email>joan.cerda@irta.es</email>
            </au>
         </aug>
         <insg>
            <ins id="I1">
               <p>Laboratory of Institut de Recerca i Tecnologia Agroaliment&#224;ries (IRTA)-Institut de Ci&#232;ncies del Mar, Consejo Superior de Investigaciones Cient&#237;ficas (CSIC), 08003 Barcelona, Spain</p>
            </ins>
            <ins id="I2">
               <p>Centro de Investigaci&#243;n Biom&#233;dica en Red de Enfermedades Hep&#225;ticas y Digestivas (CIBERehd), 08036 Barcelona, Spain</p>
            </ins>
            <ins id="I3">
               <p>G&#233;nomique et Physiologie des Poissons, Universit&#233; Bordeaux 1, UMR NuAGe, 33405 Talence, France</p>
            </ins>
            <ins id="I4">
               <p>Omnia Molecular, Barcelona Science Park, 08028 Barcelona, Spain</p>
            </ins>
            <ins id="I5">
               <p>Laboratory of Environmental Toxicology, Universidad Polit&#233;cnica de Catalunya, 08220 Terrassa, Spain</p>
            </ins>
         </insg>
         <source>BMC Evolutionary Biology</source>
         <issn>1471-2148</issn>
         <pubdate>2008</pubdate>
         <volume>8</volume>
         <issue>1</issue>
         <fpage>259</fpage>
         <url>http://www.biomedcentral.com/1471-2148/8/259</url>
         <xrefbib>
            <pubidlist>
               <pubid idtype="pmpid">18811940</pubid>
               <pubid idtype="doi">10.1186/1471-2148-8-259</pubid>
            </pubidlist>
         </xrefbib>
      </bibl>
      <history>
         <rec>
            <date>
               <day>23</day>
               <month>6</month>
               <year>2008</year>
            </date>
         </rec>
         <acc>
            <date>
               <day>23</day>
               <month>9</month>
               <year>2008</year>
            </date>
         </acc>
         <pub>
            <date>
               <day>23</day>
               <month>9</month>
               <year>2008</year>
            </date>
         </pub>
      </history>
      <cpyrt>
         <year>2008</year>
         <collab>Tingaud-Sequeira et al; licensee BioMed Central Ltd.</collab>
         <note>This is an Open Access article distributed under the terms of the Creative Commons Attribution License (<url>http://creativecommons.org/licenses/by/2.0</url>), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.</note>
      </cpyrt>
      <abs>
         <sec>
            <st>
               <p>Abstract</p>
            </st>
            <sec>
               <st>
                  <p>Background</p>
               </st>
               <p>Teleost radiation in the oceans required specific physiological adaptations in eggs and early embryos to survive in the hyper-osmotic seawater. Investigating the evolution of aquaporins (AQPs) in these vertebrates should help to elucidate how mechanisms for water homeostasis evolved. The marine teleost gilthead sea bream (<it>Sparus aurata</it>) has a mammalian aquaporin-1 (AQP1)-related channel, termed AQP1o, with a specialized physiological role in mediating egg hydration. However, teleosts have an additional AQP isoform structurally more similar to AQP1, though its relationship with AQP1o is unclear.</p>
            </sec>
            <sec>
               <st>
                  <p>Results</p>
               </st>
               <p>By using phylogenetic and genomic analyses we show here that teleosts, unlike tetrapods, have two closely linked AQP1 paralogous genes, termed <it>aqp1a </it>and <it>aqp1b </it>(formerly AQP1o). In marine teleosts that produce hydrated eggs, <it>aqp1b </it>is highly expressed in the ovary, whereas in freshwater species that produce non-hydrated eggs, <it>aqp1b </it>has a completely different expression pattern or is not found in the genome. Both Aqp1a and Aqp1b are functional water-selective channels when expressed in <it>Xenopus laevis </it>oocytes. However, expression of chimeric and mutated proteins in oocytes revealed that the sea bream Aqp1b C-terminus, unlike that of Aqp1a, contains specific residues involved in the control of Aqp1b intracellular trafficking through phosphorylation-independent and -dependent mechanisms.</p>
            </sec>
            <sec>
               <st>
                  <p>Conclusion</p>
               </st>
               <p>We propose that 1) Aqp1a and Aqp1b are encoded by distinct genes that probably originated specifically in the teleost lineage by duplication of a common ancestor soon after divergence from tetrapods, 2) Aqp1b possibly represents a neofunctionalized AQP adapted to oocytes of marine and catadromous teleosts, thereby contributing to a water reservoir in eggs and early embryos that increases their survival in the ocean, and 3) Aqp1b independently acquired regulatory domains in the cytoplasmatic C-terminal tail for the specific control of Aqp1b expression in the plasma membrane.</p>
            </sec>
         </sec>
      </abs>
   </fm>
   <bdy>
      <sec>
         <st>
            <p>Background</p>
         </st>
         <p>Membrane intrinsic proteins (MIP) such as aquaporins (AQP) are molecular channels present from bacteria to humans that transport water and small molecular weight solutes across biological membranes <abbrgrp><abbr bid="B1">1</abbr></abbrgrp>. These membrane proteins are classified into two groups: those that are water-selective, and those that also transport small neutral molecules, such as glycerol and urea, termed aqua(glycero)porins. All known AQPs have six transmembrane domains connected by five loops (A-E), in which both the N- and C-termini are cytoplasmic. Their primary structure can be divided into two similar halves each of which bear the highly conserved Asn-Pro-Ala (NPA) motif in loops B and E that are involved in the formation of the water pore, which is the hallmark of the MIP family <abbrgrp><abbr bid="B1">1</abbr><abbr bid="B2">2</abbr></abbrgrp>. In higher vertebrates, 13 different AQPs have been described, which differ in tissue expression, regulation and selectivity <abbrgrp><abbr bid="B1">1</abbr><abbr bid="B3">3</abbr></abbrgrp>.</p>
         <p>Recent studies have shown that, in mammals, AQP1 and AQP2 are essential for water resorption in the kidney <abbrgrp><abbr bid="B4">4</abbr></abbrgrp>, AQP4 is involved in cerebral water balance, astrocyte migration and neural signal transduction <abbrgrp><abbr bid="B5">5</abbr></abbrgrp>, and AQP3 and AQP7 seem to play important roles during skin hydration and metabolism of adipocytes, respectively <abbrgrp><abbr bid="B6">6</abbr></abbrgrp>. However, there is little information on the functional properties and physiological functions of AQPs in teleosts, vertebrates which form a highly diverse group of organisms adapted to living both in freshwater and seawater.</p>
         <p>Marine teleosts are thought to have colonized the oceans after a long freshwater ancestry, which is supported by the fossil record and by the hypo-osmotic condition and the presence of a glomerular kidney in extant marine species (see <abbrgrp><abbr bid="B7">7</abbr></abbrgrp> for review). The re-entry of teleosts into seawater, however, most likely required new molecular adaptations to maintain water homeostasis, which is especially important for gametes and early embryos that do not have osmoregulatory systems. The spawning of pelagic eggs by many marine teleosts (termed pelagophils), where water content may reach up to 95% in weight, has been proposed as a mechanism to provide a water reservoir in the embryo to compensate for the passive water efflux due to the hyper-osmotic effect of the seawater until osmoregulatory organs develop <abbrgrp><abbr bid="B7">7</abbr><abbr bid="B8">8</abbr></abbrgrp>. In addition, hydration of the egg contributes to buoyancy, thereby improving oxygen exchange and dispersal in the ocean.</p>
         <p>Egg hydration in marine fish occurs during the later stages of oogenesis, prior to ovulation (i.e., oocyte meiotic maturation). It is driven by the osmotic gradient created by the generation of a large pool of free amino acids (FAAs) in the oocyte, produced from the hydrolysis of vitellogenin (Vtg)-derived yolk proteins, and the accumulation of inorganic ions (see <abbrgrp><abbr bid="B9">9</abbr></abbrgrp> for review]. In the pelagophil teleost gilthead sea bream (<it>Sparus aurata</it>), we recently showed that water influx into the oocyte is facilitated by a novel water-selective AQP, predominantly expressed in the ovary, which, being structurally and functionally similar to mammalian AQP1, was named the <it>S. aurata </it>aquaporin-1 of the ovary (SaAQP1o) <abbrgrp><abbr bid="B10">10</abbr><abbr bid="B11">11</abbr></abbrgrp>. This finding illustrates how marine teleosts have evolved novel molecular mechanisms to face life in the ocean. However, sea bream also expresses another water-selective, AQP1-related channel, termed SaAQP1, which is more similar to mammalian AQP1 and is ubiquitiously distributed in tissues, including osmoregulatory organs such as the kidney, gills and intestine <abbrgrp><abbr bid="B10">10</abbr><abbr bid="B12">12</abbr></abbrgrp>. Water channels related to SaAQP1o and SaAQP1 have also been found in other teleosts <abbrgrp><abbr bid="B13">13</abbr><abbr bid="B14">14</abbr><abbr bid="B15">15</abbr></abbrgrp>, but the phylogenetic and functional relationships between these two vertebrate AQPs remain unclear.</p>
         <p>Now that the genome of several teleosts has been completely or partially sequenced, and there is an increasing number of expressed sequence tags (ESTs) and cDNAs available, the phylogeny and functional properties of teleost AQP1-like proteins can be investigated. Using phylogenetic reconstruction and genomic analysis, we show here that the AQP1o gene (<it>aqp1b</it>) is teleost specific and probably originated by local duplication of a vertebrate AQP1 ancestor, while tetrapods have only a single <it>AQP1 </it>gene structurally more similar to teleost AQP1 (<it>aqp1a</it>). Expression analyses and functional characterization in <it>Xenopus laevis </it>oocytes suggest that teleost Aqp1b represents a neofunctionalized water channel in the ovary and some osmoregulatory organs of marine species, which has evolved unique regulatory domains at the C-terminal cytoplasmic tail for the control of intracellular trafficking.</p>
      </sec>
      <sec>
         <st>
            <p>Results</p>
         </st>
         <sec>
            <st>
               <p>Duplication of AQP1 in teleosts</p>
            </st>
            <p>AQP1-related, non-redundant amino acid sequences of teleosts were obtained by searching available genome and protein databases, and by cDNA cloning. The teleost sequences were aligned with the amino acid sequence of tetrapod AQP1 and the phylogenetic analyses conducted using the neighbour-joining (NJ), maximum likelihood (ML), and Bayesian inference (BI) methods (Figure <figr fid="F1">1</figr>; see also Additional file <supplr sid="S1">1</supplr>). The phylogenetic tree obtained consistently separated tetrapod AQP1 from the teleost lineage (NJ: 100; ML: 100; BI: 100), which appeared to have undergone a duplication event giving rise to the Aqp1a and Aqp1b subgroups (NJ: 92; ML: 46; BI: 96). The length of the branches of Aqp1b sequences were in general longer than those of Aqp1a, specially that of the zebrafish Aqp1b, suggesting a higher rate of residue mutations than members of the parent group, and hence a rapid evolution. Zebrafish (<it>Danio rerio</it>) Aqp1b, however, clustered significantly outside the Aqp1a and Aqp1b subgroups, which may be a result of the well-known long-branch attraction effect that can pull long branches towards the outgroup (in this case the tetrapods). In the amphibian <it>Bufo marinus</it>, two AQP1 sequences were found, termed <it>Bufo </it>a and <it>Bufo </it>b, that clustered together with the other amphibian AQP1, confirming that neither was a homolog of the teleost Aqp1b subgroup. These results confirmed the presence of two paralogous gene copies early in the Actinopterygii (Teleostei) lineage, related to human AQP1, that may have arisen after an early duplication event of an ancestral AQP1 gene. Thus, the two paralogous genes were termed <it>aqp1a </it>and <it>aqp1b </it>according to the nomenclature established for zebrafish <abbrgrp><abbr bid="B16">16</abbr></abbrgrp>. The cDNAs encoding sea bream SaAQP1 and SaAQP1o, and Senegalese sole (<it>Solea senegalensis</it>) AQP1o, previously isolated <abbrgrp><abbr bid="B10">10</abbr></abbrgrp>, correspond to the transcripts of <it>aqp1a </it>and <it>aqp1b </it>paralogs, respectively. The European eel (<it>Anguilla anguilla</it>) Aqp1b cDNA that we cloned here is 100% identical to that recently isolated from the same species and named AQP1dup <abbrgrp><abbr bid="B14">14</abbr></abbrgrp>.</p>
            <suppl id="S1">
               <title>
                  <p>Additional file 1</p>
               </title>
               <text>
                  <p><b>Alignment of the amino acid sequences of vertebrate AQP1 and teleost Aqp1a and Aqp1b</b>. Alignment was performed using ClustalW employing the sequence from loop B to the start of the C-terminus, manually optimized using the Bioedit software. Conserved residues are shaded in black, residues conserved in at least 70% of the species in grey.</p>
               </text>
               <file name="1471-2148-8-259-S1.pdf">
                  <p>Click here for file</p>
               </file>
            </suppl>
            <fig id="F1">
               <title>
                  <p>Figure 1</p>
               </title>
               <caption>
                  <p>Phylogenetic relationships of AQP1-like proteins in vertebrates</p>
               </caption>
               <text>
                  <p><b>Phylogenetic relationships of AQP1-like proteins in vertebrates</b>. Bayesian majority rule consensus phylogenetic tree for the amino acid alignment of teleost and tetrapod AQP1-like sequences. Nodes with &#8805;70% Bayesian posterior probabilities are shown. Branch lengths are proportional to BI estimates of numbers of amino acid substitutions. The GenBank accession number, scaffold, or chromosome group are indicated in parenthesis for each sequence.</p>
               </text>
               <graphic file="1471-2148-8-259-1"/>
            </fig>
         </sec>
         <sec>
            <st>
               <p>Genomic organization of teleost <it>aqp1 </it>and <it>aqp1b </it>and primary structure of the encoded polypeptides</p>
            </st>
            <p>In the genome of pufferfish (<it>Tetraodon nigroviridis</it>), zebrafish, stickleback (<it>Gasterosteus aculeatus</it>) and fugu (<it>Takifugu rubripes</it>), <it>aqp1a </it>and <it>aqp1b </it>are located in the same chromosome (15, 2, III, and scaffold 68, respectively). In all these species, both chromosome loci were found to be linked, <it>aqp1b </it>being downstream of <it>aqp1a</it>. Based on this synteny, the corresponding genomic region in sea bream was obtained by PCR, employing cDNA-based oligonucleotides, and sequenced, to compare the genomic organization of <it>aqp1a </it>and <it>aqp1b </it>between extant and more primitive teleosts (Figure <figr fid="F2">2</figr>). In zebrafish, <it>aqp1a </it>and <it>aqp1b </it>were separated by 16.4 kb and were 11.6 kb and 3.6 kb in length, respectively, whereas in sea bream both loci were separated by approximately 10 kb and were 2.1 kb and 2.8 kb in length, respectively. In fugu and <it>Tetraodon</it>, which have more compact genomes, <it>aqp1a </it>and <it>aqp1b </it>were 1.4&#8211;1.5 kb and 1.1&#8211;1.2 kb in length, respectively, both loci being separated by only 4.1&#8211;4.7 kb. However, in medaka (<it>Oryzias latipes</it>) only the <it>aqp1a </it>loci could be found in available genome sequence databases and it was 3.1 kb in length. In all teleosts analyzed, <it>aqp1a </it>and <it>aqp1b </it>were organized into 4 exons of 354&#8211;366 bp, 162&#8211;165 bp, 81 bp, and 177&#8211;204 bp in length, for exon 1, exon 2, exon 3, and exon 4, respectively. Comparison of the nucleotide sequence of exon 1, exon 2 and exon 3 between <it>aqp1a </it>and <it>aqp1b </it>within the same species showed 64&#8211;74% identity, while the sequence of exon 4, which encodes the C-terminal amino acid sequence, was only 57&#8211;58% identical.</p>
            <fig id="F2">
               <title>
                  <p>Figure 2</p>
               </title>
               <caption>
                  <p>Genomic organization of human AQP1 and teleost <it>aqp1a </it>and <it>aqp1b </it>genes</p>
               </caption>
               <text>
                  <p><b>Genomic organization of human AQP1 and teleost <it>aqp1a </it>and <it>aqp1b </it>genes</b>. Schematic representation of human AQP1 <abbrgrp><abbr bid="B67">67</abbr></abbrgrp>, and zebrafish, fugu, medaka and sea bream <it>aqp1a </it>and <it>aqp1b </it>gene loci. White (human AQP1 and teleost <it>aqp1a</it>) and grey (teleost <it>aqp1b</it>) boxes indicate exons with coding regions only. Downstream genes from human <it>AQP1</it> and teleost <it>aqp1b</it> are growth hormone releasing hormone receptor (<it>GHRHR</it>) and THO complex subunit 1 (<it>thoc1</it>), respectively.</p>
               </text>
               <graphic file="1471-2148-8-259-2"/>
            </fig>
            <p>The deduced Aqp1a amino acid sequence was slightly more similar to human AQP1 (60&#8211;61% identity) than that of Aqp1b (51&#8211;56% identity). Comparison of the primary structure of AQP1-like polypeptides between human and teleosts (Figure <figr fid="F3">3</figr>) indicated that Aqp1a and Aqp1b sequences have the six potential transmembrane domains and the two NPA motifs, as well as the residues of the pore-forming region (Phe<sup>56</sup>, His<sup>180 </sup>and Arg<sup>195</sup>; human AQP1 numbering) that are conserved in water-selective AQPs <abbrgrp><abbr bid="B17">17</abbr></abbrgrp>. In addition, in both Aqp1a and Aqp1b amino acid sequences, the Cys residue were before the second NPA motif (Cys<sup>178 </sup>for sea bream Aqp1a and Aqp1b), which is the site in mammalian AQP1 potentially responsible for the inhibition of water permeability by mercurial compounds <abbrgrp><abbr bid="B18">18</abbr></abbrgrp>. However, teleost Aqp1a and Aqp1b share only 61&#8211;64% identity, the lowest identity being at the level of the C-terminus (8&#8211;27%). The amino acid sequence of Aqp1a, including the C-terminus, among teleost species was relatively similar (69&#8211;95% identity), while that of Aqp1b appeared to be more divergent (51&#8211;76% identity among species) especially at the C-terminus (11&#8211;50% identity).</p>
            <fig id="F3">
               <title>
                  <p>Figure 3</p>
               </title>
               <caption>
                  <p>Amino acid sequence alignment of human AQP1 and teleost Aqp1a and Aqp1b</p>
               </caption>
               <text>
                  <p><b>Amino acid sequence alignment of human AQP1 and teleost Aqp1a and Aqp1b</b>. The six transmembrane (TM) domains and connecting loops A-B of human AQP1 are indicated by brackets and horizontal arrows, respectively. The vertical arrows above human AQP1 show the conserved residues Phe<sup>56</sup>, His<sup>180 </sup>and Arg<sup>195 </sup>(human AQP1 numbering) in water-selective AQPs. Identical residues between human AQP1 and teleost AQP1-like sequences are indicated with an asterisk, whereas conserved amino acid substitutions and substitutions with similar amino acids are indicated by a double or single dot, respectively. Residues conserved in human and most teleost sequences are shaded in black, and residues different from human but conserved between most of the teleost Aqp1a and Aqp1b sequences are shaded in grey.</p>
               </text>
               <graphic file="1471-2148-8-259-3"/>
            </fig>
         </sec>
         <sec>
            <st>
               <p>Functional Aqp1b is predominantly expressed in the ovary of marine and catadromous teleosts</p>
            </st>
            <p>Previous studies have reported that sea bream <it>aqp1b </it>mRNA is predominantly expressed in the ovary, whereas sea bream and eel <it>aqp1a </it>mRNA is ubiquitously expressed <abbrgrp><abbr bid="B10">10</abbr><abbr bid="B19">19</abbr></abbrgrp>. We investigated the expression pattern of <it>aqp1b </it>in teleosts belonging to different taxonomic groups that also have different reproductive strategies, such as Senegalese sole (Pleuronectiformes; marine), European eel (Anguilliformes; catadromous, i.e., live in freshwater and migrate to the sea to breed) and zebrafish (Cypriniformes; strict freshwater). The RT-PCR analysis confirmed that in pelagophil species, such as sea bream, sole and eel, <it>aqp1b </it>transcripts were highly abundant in mature (hydrated) ovaries, although it was also expressed in kidney, intestine and gills (Figure <figr fid="F4">4A&#8211;C</figr>). In contrast, in zebrafish <it>aqp1b </it>transcripts were detected at lower and similar levels in brain, ovary and testis (Figure <figr fid="F4">4D</figr>), thus showing a completely different expression pattern than in the other species. In zebrafish and sole, <it>aqp1a </it>mRNA was detected in all adult tissues examined, similarly to that reported in sea bream and eel (data not shown).</p>
            <fig id="F4">
               <title>
                  <p>Figure 4</p>
               </title>
               <caption>
                  <p>Gene expression pattern and functional characterization of teleost Aqp1b</p>
               </caption>
               <text>
                  <p><b>Gene expression pattern and functional characterization of teleost Aqp1b</b>. (A-D) Representative RT-PCR analysis of <it>aqp1b </it>(upper panels) and <it>bactin </it>(lower panels) transcripts in sea bream (A), European eel (B), Senegalese sole (C) and zebrafish (D) tissues. PCR products were detected by Southern blot. Minus indicates absence of RT during cDNA synthesis. The size (kb) of PCR products and molecular markers are indicated on the left and right, respectively. (E) <it>P</it><sub>f </sub>and Hg<sup>2+ </sup>inhibition of <it>X. laevis </it>oocytes expressing teleost Aqp1a or Aqp1b. Oocytes were injected with cRNAs encoding sea bream Aqp1a or Aqp1b (1 ng), eel Aqp1b (10 ng), Senegalese sole Aqp1b (10 ng) or zebrafish Aqp1b (10 ng), or with 50 nl of water (control). The <it>P</it><sub>f </sub>was assayed in the presence or absence of 0.7 mM HgCl<sub>2</sub>. Some oocytes treated with HgCl<sub>2 </sub>were incubated with 5 mM &#946;-mercaptoethanol (&#946;ME) for 15 min before swelling measurements. Values represent the mean &#177; SEM (<it>n </it>= 6&#8211;10 oocytes) from a representative experiment.</p>
               </text>
               <graphic file="1471-2148-8-259-4"/>
            </fig>
            <p>The highly conserved amino acid sequence of loops B and E of teleost Aqp1a and Aqp1b with respect to those of human AQP1 suggest that fish Aqp1b paralogs might encode functional water channels. To test this, <it>X. laevis </it>oocytes injected with cRNAs encoding sea bream Aqp1a or Aqp1b, sole Aqp1b, eel Aqp1b or zebrafish Aqp1b were compared with oocytes injected with 50 nl of water (Figure <figr fid="F4">4E</figr>). Coefficients of water osmotic permeability (<it>P</it><sub>f</sub>) were determined from rates of oocyte swelling after transfer to hypoosmotic MBS. Water-injected oocytes exhibited low water permeability, whereas the <it>P</it><sub>f </sub>of sea bream Aqp1a oocytes was increased by 10-fold, sea bream Aqp1b and eel Aqp1b oocytes by 8-fold, sole Aqp1b oocytes by 6-fold, and zebrafish Aqp1b oocytes by 4-fold. The presence of 0.7 mM HgCl<sub>2 </sub>reduced the <it>P</it><sub>f </sub>of both Aqp1a- and Aqp1b-injected oocytes (82.6 &#177; 2.1% and 50.2 &#177; 3.1%, respectively). The inhibition was partially recovered (52.2 &#177; 8.3% and 27.5 &#177; 10.3%, for Aqp1a and Aqp1b, respectively) by incubation of oocytes with 5 mM &#946;-mercaptoethanol.</p>
         </sec>
         <sec>
            <st>
               <p>Sea bream Aqp1a and Aqp1b are differentially translocated into the oocyte plasma membrane</p>
            </st>
            <p>Previous functional analyses indicated that oocytes expressing sea bream Aqp1a were more permeable than those expressing Aqp1b. To investigate whether both AQPs were differentially expressed or translocated in the oocyte cytoplasm, a series of dose-response experiments, injecting increasing amounts of Aqp1a or Aqp1b cRNA followed by Western blot and immunocytochemical analyses, were carried out (Figure <figr fid="F5">5</figr>). At all doses tested (from 0.05 to 10 ng cRNA), the <it>P</it><sub>f </sub>of oocytes expressing Aqp1b was lower than that of oocytes expressing Aqp1a (Figure <figr fid="F5">5A</figr>), while protein expression levels resulting from both cRNAs were similar (Figure <figr fid="F5">5B</figr>, lane TM). Immunocytochemistry on sections of these oocytes revealed that Aqp1a was present in the plasma membrane (Figure <figr fid="F5">5D</figr>), whereas Aqp1b was also detected just below the plasma membrane, possibly in vesicles (Figure <figr fid="F5">5E</figr>). This staining was specific for Aqp1b since control oocytes, not injected or injected with water, were unstained (Figure <figr fid="F5">5C</figr>). Western blots of protein extracts from total and plasma membranes of oocytes showed there was a higher proportion of Aqp1a in the plasma membrane when compared with Aqp1b (Figure <figr fid="F5">5B</figr>), confirming that Aqp1b was retained in the cytoplasm. However, immunoblots of total and plasma membrane of Aqp1b-expressing oocytes revealed the presence of two reactive bands of approximately 28 and 29 kDa after incubation with the Aqp1b antisera (Figure <figr fid="F5">5B</figr>, arrows). Both bands were visible in total and plasma membrane fractions, although the 29-kDa band was much weaker in the plasma membrane fraction. Alkaline phosphatase treatment of total membrane proteins before SDS-PAGE prevented the detection of the 29-kDa polypeptide, indicating that this band corresponded to a phophorylated form of Aqp1b (Figure <figr fid="F5">5F</figr>).</p>
            <fig id="F5">
               <title>
                  <p>Figure 5</p>
               </title>
               <caption>
                  <p>Differential localization of sea bream Aqp1a and Aqp1b expressed in <it>X. laevis </it>oocytes</p>
               </caption>
               <text>
                  <p><b>Differential localization of sea bream Aqp1a and Aqp1b expressed in <it>X. laevis </it>oocytes</b>. (A) <it>P</it><sub>f </sub>of oocytes expressing increasing amounts of Aqp1a or Aqp1b cRNA. Values represent the mean &#177; SEM (<it>n </it>= 6&#8211;10 oocytes) from 3 independent experiments. (B) Immunoblots of total and plasma membrane equivalents (TM and PM, respectively) of oocytes expressing 1 ng of Aqp1a or Aqp1b. The arrows indicate two very close Aqp1b reactive bands. (C-E) Immunofluoresence microscopy of water-injected and Aqp1a- or Aqp1b-expressing oocytes. Arrows show localization of the protein at the plasma membrane. The arrowhead indicates Aqp1b in the cytoplasm below the plasma membrane. Bar, 50 &#956;m. (F) Immunoblot of total membrane fraction of Aqp1b-expressing oocytes incubated with or without alkaline phosphatase (AP) for 6 h. In B and F, the apparent molecular mass of a 29-kDa marker is indicated on the left and right, respectively.</p>
               </text>
               <graphic file="1471-2148-8-259-5"/>
            </fig>
         </sec>
         <sec>
            <st>
               <p>Role of sea bream Aqp1b C-terminus for Aqp1b cell surface expression</p>
            </st>
            <p>As indicated, the most divergent region between the amino acid sequence of sea bream Aqp1a and Aqp1b was the C-terminus. Since it is known that the cytoplasmic tail plays a role in the intracellular trafficking of some mammalian <abbrgrp><abbr bid="B20">20</abbr></abbrgrp> and amphibian <abbrgrp><abbr bid="B21">21</abbr></abbrgrp> AQPs, we studied whether this region was involved in the control of Aqp1b translocation into the oocyte plasma membrane. Expression vectors were made in which either the C-terminal tail of Aqp1a was exchanged with that of Aqp1b (Aqp1a-Ct1b), or the C-terminus of Aqp1b with that of Aqp1a (Aqp1b-Ct1a), in both cases starting at Pro<sup>222</sup>. The two chimeras, as well as wild-type Aqp1a and Aqp1b, were expressed in oocytes and the <it>P</it><sub>f </sub>and protein expression at the oocyte plasma membrane monitored (Figure <figr fid="F6">6A&#8211;E</figr>). Expression of Aqp1a-Ct1b reduced swelling by 53.8 &#177; 5.2% when compared with oocytes expressing wild-type Aqp1a, whereas water permeability of oocytes expressing Aqp1b-Ct1a was increased by 37.1 &#177; 8.1% with respect to wild-type Aqp1b-expressing oocytes (Figure <figr fid="F6">6F</figr>). Oocyte permeability positively correlated with accumulation of intact and chimera AQP in the plasma membrane, with both Aqp1a and Aqp1b-Ct1a being exclusively localized at the membrane (Figure <figr fid="F6">6G</figr> and <figr fid="F6">6J</figr>), whereas Aqp1b and Aqp1a-Ct1b were also present in the cytoplasm (Figure <figr fid="F6">6H</figr> and <figr fid="F6">6I</figr>). Western blot of total and plasma membranes revealed the presence of a single 27-kDa band in Aqp1a and Aqp1b-Ct1a oocytes, while Aqp1b and Aqp1a-Ct1b oocytes had the 28- and 29-kDa bands or a smear band of 27 to 29 kDa, respectively (Figure <figr fid="F6">6K</figr> and <figr fid="F6">6L</figr>). These observations suggest that retention of Aqp1b in the oocyte cytoplasm may be associated to phosphorylation at the level of the C-terminus.</p>
            <fig id="F6">
               <title>
                  <p>Figure 6</p>
               </title>
               <caption>
                  <p>Functional properties and subcellular localization of wild-type (WT) sea bream Aqp1a and Aqp1b, and of their chimeric proteins, in oocytes</p>
               </caption>
               <text>
                  <p><b>Functional properties and subcellular localization of wild-type (WT) sea bream Aqp1a and Aqp1b, and of their chimeric proteins, in oocytes</b>. (A) Membrane topology of AQP family members showing the six transmembrane helices with five connecting loops (<it>A</it>-<it>E</it>), and two conserved Asn-Pro-Ala (NPA) motifs in loops <it>B </it>and <it>E</it>. (B-E) WT Aqp1a (B) and Aqp1b (C), Aqp1a chimera in which the C-terminus of Aqp1a was exchanged with that of Aqp1b (Aqp1a-Ct1b; D), and Aqp1b chimera in which the C-terminus of Aqp1b was exchanged with that of Aqp1a (Aqp1b-Ct1a; E). (F) <it>P</it><sub>f </sub>of oocytes expressing 1 ng of cRNA encoding WT or chimeric proteins. Values represent the mean &#177; SEM (<it>n </it>= 5&#8211;8 oocytes) from a representative experiment. The asterisk denotes statistically significant differences (<it>p </it>&lt; 0.01). (G-J) Immunofluorescence microscopy of oocytes localizing WT Aqp1a and Aqp1b-Ct1a exclusively at the plasma membrane, whereas WT Aqp1b and Aqp1a-Ct1b are also in the cytoplasm. Sections shown in G and J were probed with the anti-Aqp1a antisera, whereas the sections in H and I were probed with the anti-Aqp1b antisera. Bar, 50 &#956;m. (K-L) Immunoblots of total and plasma membrane equivalents (TM and PM, respectively) of oocytes expressing the differents cRNAs. Blots were probed as indicate above. The apparent molecular mass of a 29-kDa marker is indicated on the left.</p>
               </text>
               <graphic file="1471-2148-8-259-6"/>
            </fig>
         </sec>
         <sec>
            <st>
               <p>In silico analysis of teleost Aqp1b C-terminal amino acid sequence</p>
            </st>
            <p>The C-terminal amino acid sequence of Aqp1a and Aqp1b from different teleosts was searched for potential regulatory sites (Figure <figr fid="F7">7</figr>). Unlike human AQP1, both Aqp1a and Aqp1b sequences showed typical sorting and internalization motifs ([D/E/R]XXXL [L/V/I]) in the cytoplasmic tail, common in transmembrane proteins <abbrgrp><abbr bid="B22">22</abbr></abbrgrp>. These signals appeared to be highly conserved in fish Aqp1a (with the consensus sequence R [M/V] [K/R]VLV), whereas in Aqp1b they were more variable, although all of them included a di-Leu or Leu-Ile motif. Teleost Aqp1a and Aqp1b also had a variable number of Ser, Tyr and Thr residues with a high probability of being phosphorylated. Among these residues, Ser<sup>254 </sup>in sea bream Aqp1b had a high phosphorylation score (0.98) and fulfilled the criteria for a Pro-directed kinase phosphorylation site ([S/T]P preceded by a docking domain [R/K]XXXX&#216;X&#216;; &#216; denotes hydrophobic residue; <abbrgrp><abbr bid="B23">23</abbr><abbr bid="B24">24</abbr></abbrgrp>). The same consensus site was found in the C-terminus of fugu (Ser<sup>245</sup>; score 0.97) and sole (Ser<sup>230</sup>; score 0.95) Aqp1b, but not in that of eel, stickleback or zebrafish Aqp1b, although these sequences, except that of eel, had one or more Ser residues with a high phosphorylation score (&#8805; 0.9). Some of these residues matched a casein kinase 1 (CK1) phosphorylation site (Ser<sup>230 </sup>and Ser<sup>260</sup>, in sole and zebrafish Aqp1b, respectively), or a CK2 site (Ser<sup>230</sup>, Ser<sup>237 </sup>and Ser<sup>247</sup>, in sole, stickleback and zebrafish, respectively). In addition, a Thr residue preceding the sorting signal appeared to be conserved only in teleost Aqp1b sequences (Thr<sup>229</sup>, Thr<sup>235</sup>, Thr<sup>229 </sup>and Thr<sup>230</sup>, in sea bream, sole, stickleback and eel, respectively), except in fugu and zebrafish, where it was replaced by Phe<sup>227 </sup>and Lys<sup>233</sup>, respectively. However, none of these Thr residues gave a relevant phosphorylation score.</p>
            <fig id="F7">
               <title>
                  <p>Figure 7</p>
               </title>
               <caption>
                  <p>Amino acid sequence alignment of the C termini of human AQP1, and Aqp1a and Aqp1b from representative teleosts</p>
               </caption>
               <text>
                  <p><b>Amino acid sequence alignment of the C termini of human AQP1, and Aqp1a and Aqp1b from representative teleosts</b>. At the bottom, identical residues are indicated by asterisks, whereas conserved amino acid substitutions and substitutions with similar amino acids are indicated by double or single dots, respectively. Residues of teleost Aqp1a and Aqp1b conserved in human AQP1 are in bold, and conserved residues in Aqp1a sequences are boxed. Double underlined residues indicate typical potential sorting and internalization sequences, whereas those single underlined indicate other sorting-like motifs. In each sequence, potential Ser, Thr and Tyr phosphorylation sites (score &#8805; 0.9) are indicated by arrowheads. Consensus sites for potential kinases are indicated: grey, candidate Pro-directed kinase and preceding docking domain; arrows, casein kinase I (CK1); circles, CK2. Other candidate phosphorylation sites shown do not match any eukaryotic linear functional motif included in the ELM resource.</p>
               </text>
               <graphic file="1471-2148-8-259-7"/>
            </fig>
         </sec>
         <sec>
            <st>
               <p>Involvement of specific residues in sea bream Aqp1b C-terminus in intracellular trafficking</p>
            </st>
            <p>To investigate the potential role of the semi-conserved C-terminal Ser and Thr residues in Aqp1b intracellular trafficking, sea bream Aqp1b Ser<sup>254 </sup>and Thr<sup>229 </sup>were independently mutated into Ala or Asp to mimic non-phosphorylated and phosphorylated states, respectively (Table <tblr tid="T1">1</tblr>). The Leu<sup>234</sup>Leu<sup>235 </sup>motif in this sequence was also mutated into an Ala pair. Wild-type and mutated proteins were then expressed in oocytes to determine their permeability and subcellullar localization as indicated above (Figure <figr fid="F8">8</figr>). Swelling assays showed that Aqp1b-T229A and Aqp1b-L234A/L235A mutants reduced water permeability by 38.1 &#177; 2.4% and 70.1 &#177; 4.4%, respectively, with respect to oocytes expressing wild-type Aqp1b (Figure <figr fid="F8">8A</figr>). For Aqp1b-T229A mutant, reduced permeability was apparently caused by retention of the protein in cytoplasmic vesicles, although it did not affect the phosphorylation state of Aqp1b (Figure <figr fid="F8">8B</figr> and <figr fid="F8">8G</figr>). In contrast, as the mutant was predominantly localized surrounding the oocyte nucleus (i.e., germinal vesicle), the strong inhibition of water permeability showed by Aqp1b-L234A/L235A was possibly caused by the accumulation of the protein in intracellular compartments, which could enhance protein-lysosomal targeting and degradation (Figure <figr fid="F8">8C</figr> and <figr fid="F8">8H</figr>). The Aqp1b-T229D mutant was less expressed than wild-type Aqp1b (data not shown), causing low accumulation of the protein in the plasma membrane, thereby reducing oocyte water permeation (by 63.4 &#177; 4.0% inhibition). However, water permeability was higher in oocytes expressing the Aqp1b-S254A mutant than those expressing wild-type Aqp1b (65.6 &#177; 12.8% increase), associated with the absence of a phosphorylated form of the protein and increased expression in the plasma membrane (Figure <figr fid="F8">8A, D</figr> and <figr fid="F8">8I</figr>). Conversely, Aqp1b-S254D induced the retention of the protein in cytoplasmic vesicles as with Aqp1b-T229A, thus inhibiting protein translocation into the plasma membrane and reducing water permeability (36.7 &#177; 18.5% reduction) (Figure <figr fid="F8">8A, E</figr> and <figr fid="F8">8J</figr>). Other Ser residues present in the C-terminal region of sea bream Aqp1b, Ser<sup>238</sup>, Ser<sup>253</sup>, Ser<sup>258 </sup>and Ser<sup>262</sup>, were also substituted by Ala but these mutants had no effect on water permeability with respect to wild-type Aqp1b (see Additional file <supplr sid="S2">2</supplr>). These data suggest that dephosphorylation of Ser<sup>254 </sup>may enhance Aqp1b shuttling into the plasma membrane, and that Thr<sup>229 </sup>may also regulate this process through a phosphorylation-independent mechanism.</p>
            <suppl id="S2">
               <title>
                  <p>Additional file 2</p>
               </title>
               <text>
                  <p><b>Water permeability of <it>X. laevis </it>oocytes expressing sea bream wild-type (WT) or mutant Aqp1b</b>. The Aqp1b-S238A, Aqp1b-S253A, Aqp1b-S258A and Aqp1b-S262A mutants are shown. (A) Water permeability of oocytes expressing 1 ng cRNA of WT Aqp1b or the different mutants. Permeability is expressed in % related to oocytes injected with wild-type Aqp1b. Values represent the mean &#177; SEM of 3 experiments (each performed with different batches of oocytes; n = 10&#8211;15 oocytes per treatment). (B) Immunoblots of total membrane equivalents of oocytes expressing WT or mutant Aqp1b showing that all proteins were expressed at similar levels. The apparent molecular mass of a 29-kDa marker is indicated on the left.</p>
               </text>
               <file name="1471-2148-8-259-S2.pdf">
                  <p>Click here for file</p>
               </file>
            </suppl>
            <fig id="F8">
               <title>
                  <p>Figure 8</p>
               </title>
               <caption>
                  <p>Role of specific residues in the sea bream Aqp1b C-terminal tail for intracellular trafficking in oocytes</p>
               </caption>
               <text>
                  <p><b>Role of specific residues in the sea bream Aqp1b C-terminal tail for intracellular trafficking in oocytes</b>. (A) Water permeability of oocytes expressing wild-type (WT) or mutant Aqp1b. Oocytes were injected with cRNAs encoding WT Aqp1b (0.25 or 1 ng), Aqp1b-T229A (1 ng), Aqp1b-L234A/L235A (1 ng), Aqp1b-S254A (0.25 ng) or Aqp1b-S254D (0.25 ng). Permeability is expressed in % related to oocytes injected with WT Aqp1b. Values are the mean &#177; SEM of 3&#8211;5 experiments (n = 10&#8211;15 oocytes per treatment). The asterisks denote statistically significant differences (*, <it>p </it>&lt; 0.05; **, <it>p </it>&lt; 0.01). (B-E) Immunoblots of total and plasma membrane equivalents (TM and PM, respectively) of oocytes expressing WT or mutant Aqp1b. The apparent molecular mass of a 29-kDa marker is indicated on the left. (F-J) Localization of Aqp1b mutants in oocytes. The plasma membrane is indicated by arrows, and retention of Aqp1b-L234A/L235A proteins possibly in the ER is indicated by arrowheads (H). Bars, 100 &#956;m.</p>
               </text>
               <graphic file="1471-2148-8-259-8"/>
            </fig>
            <tbl id="T1">
               <title>
                  <p>Table 1</p>
               </title>
               <caption>
                  <p>C-Terminal amino acid sequences of sea bream wild-type (WT) and mutated Aqp1b</p>
               </caption>
               <tblbdy cols="2">
                  <r>
                     <c ca="center">
                        <p>
                           <b>Construct</b>
                        </p>
                     </c>
                     <c ca="center">
                        <p>
                           <b>Aqp1b C-terminus sequence</b>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c cspan="2">
                        <hr/>
                     </c>
                  </r>
                  <r>
                     <c>
                        <p/>
                     </c>
                     <c ca="center">
                        <p>
                           <monospace>222&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;267</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c>
                        <p/>
                     </c>
                     <c ca="center">
                        <p>
                           <monospace>|&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;&#160;|</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>Aqp1b-WT</p>
                     </c>
                     <c ca="center">
                        <p>
                           <monospace>PRAQNFR<b><ul>T</ul></b>RRNV<b><ul>LL</ul></b>NG<b><ul>S</ul></b>EDEDAGFDAPREGN<b><ul>SS</ul></b>PGP<b><ul>S</ul></b>QGP<b><ul>S</ul></b>QWPKH</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>T229A</p>
                     </c>
                     <c ca="center">
                        <p>
                           <monospace>PRAQNFR<b><ul>A</ul></b>RRNVLLNGSEDEDAGFDAPREGNSSPGPSQGPSQWPKH</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>T229D</p>
                     </c>
                     <c ca="center">
                        <p>
                           <monospace>PRAQNFR<b><ul>D</ul></b>RRNVLLNGSEDEDAGFDAPREGNSSPGPSQGPSQWPKH</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>L234A/L235A</p>
                     </c>
                     <c ca="center">
                        <p>
                           <monospace>PRAQNFRTRRNV<b><ul>AA</ul></b>NGSEDEDAGFDAPREGNSSPGPSQGPSQWPKH</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>S238A</p>
                     </c>
                     <c ca="center">
                        <p>
                           <monospace>PRAQNFRTRRNVLLNG<b><ul>A</ul></b>EDEDAGFDAPREGNSSPGPSQGPSQWPKH</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>S253A</p>
                     </c>
                     <c ca="center">
                        <p>
                           <monospace>PRAQNFRTRRNVLLNGSEDEDAGFDAPREGN<b><ul>A</ul></b>SPGPSQGPSQWPKH</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>S254A</p>
                     </c>
                     <c ca="center">
                        <p>
                           <monospace>PRAQNFRTRRNVLLNGSEDEDAGFDAPREGNS<b><ul>A</ul></b>PGPSQGPSQWPKH</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>S254D</p>
                     </c>
                     <c ca="center">
                        <p>
                           <monospace>PRAQNFRTRRNVLLNGSEDEDAGFDAPREGNS<b><ul>D</ul></b>PGPSQGPSQWPKH</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>S258A</p>
                     </c>
                     <c ca="center">
                        <p>
                           <monospace>PRAQNFRTRRNVLLNGSEDEDAGFDAPREGNSSPGP<b><ul>A</ul></b>QGPSQWPKH</monospace>
                        </p>
                     </c>
                  </r>
                  <r>
                     <c ca="center">
                        <p>S262A</p>
                     </c>
                     <c ca="center">
                        <p>
                           <monospace>PRAQNFRTRRNVLLNGSEDEDAGFDAPREGNSSPGPSQGP<b><ul>A</ul></b>QWPKH</monospace>
                        </p>
                     </c>
                  </r>
               </tblbdy>
               <tblfn>
                  <p>Amino acid sequence of C termini of WT and Aqp1b mutants from Pro<sup>222 </sup>to terminal His<sup>267</sup>. Amino acid substitutions are shown in black boxes.</p>
               </tblfn>
            </tbl>
         </sec>
      </sec>
      <sec>
         <st>
            <p>Discussion</p>
         </st>
         <p>We present here strong evidence confirming the presence of two AQP isoforms in vertebrates that are structurally and functionally related to mammalian AQP1. These isoforms, Aqp1a and Aqp1b, seem to coexist exclusively in teleost fish since Aqp1b was not found in mammals, amphibians or birds. The main difference between Aqp1a and Aqp1b is in the C-terminal tail, which contains specific residues for regulation of intracellular trafficking in Aqp1b.</p>
         <p>Previous sequence analyses of MIPs suggest that substrate selective modes (AQPs and aquaglyceroporins) were acquired early in the history of the family by gene duplication and functional shift, with the highest level of diversification occurring in vertebrates and higher plants <abbrgrp><abbr bid="B25">25</abbr></abbrgrp>. Analysis of Aqp1a and Aqp1b distribution by searching currently available genome sequence information and by cDNA cloning suggest that both isoforms are present exclusively in the teleost genome. Phylogenetic reconstruction of vertebrate AQP1-like proteins indicates that Aqp1a and Aqp1b share a common origin and are likely to have evolved from duplication of a common ancestor. Because both isoforms are present in fish species belonging to distant taxonomic groups, from basal (e.g., Anguilliformes) to more modern (e.g., Gasterosteiformes, Perciformes, Pleuronectiformes and Tetraodontiformes) groups <abbrgrp><abbr bid="B26">26</abbr><abbr bid="B27">27</abbr></abbrgrp>, this duplication must be ancient and is likely to have affected most teleosts. As suggested for many duplicated genes in teleosts, the origin of Aqp1b might be the whole-genome duplication (WGD) event that occurred specifically in the ray-finned (Actinopterygian) lineage after splitting from the tetrapod lineage about 350 million years ago <abbrgrp><abbr bid="B28">28</abbr></abbrgrp>. However, as it has not been possible to identify Aqp1b in most basal actinopterygians (e.g., paddlefish and sturgeon) with the genomic information available, it is not known whether the AQP1 duplication also affected these groups. In all teleosts examined, the <it>aqp1a </it>and <it>aqp1b </it>loci were found to be closely linked, indicating that Aqp1b possibly arose by a gene duplication event at a local level rather than at the chromosome or genome level. Local gene duplication has also been proposed, for instance, to explain the repertoire of teleost opsins <abbrgrp><abbr bid="B29">29</abbr><abbr bid="B30">30</abbr></abbrgrp> and the generation of the <it>Xiphophorus Xmrk </it>oncogene <abbrgrp><abbr bid="B31">31</abbr></abbrgrp>.</p>
         <p>The radiation of teleosts in the ocean most likely required the evolution of new osmoregulatory mechanisms in eggs and early embryos to alleviate the passive water loss imposed by the hyper-osmotic environment <abbrgrp><abbr bid="B7">7</abbr></abbrgrp>. In this scenario, it is plausible to hypothesize that duplication of <it>aqp1 </it>genes in teleosts allowed for one duplicate to encode a product with a new function through innovating mutations in regulatory and/or structural sequences ('neofunctionalization'). This seems to be the case for sea bream Aqp1b which plays a specialized physiological role in the oocyte mediating water uptake during meiotic maturation <abbrgrp><abbr bid="B10">10</abbr><abbr bid="B11">11</abbr></abbrgrp>. In other marine and catadromous teleosts, such as sole and eel, respectively, that like sea bream also spawn highly hydrated eggs, we show here that <it>aqp1b </it>also encodes a functional water channel whose RNA is predominantly accumulated in the ovary, suggesting a similar role of Aqp1b during oocyte hydration. In other pelagophil teleosts <abbrgrp><abbr bid="B32">32</abbr><abbr bid="B33">33</abbr></abbrgrp>, as well as in some species of catfish, in which oocyte hydration may also occur despite having a freshwater life cycle (e.g., <abbrgrp><abbr bid="B34">34</abbr></abbrgrp>), Aqp1b-encoding ESTs have also been found in the ovary. In contrast, in zebrafish, a freshwater species where almost no oocyte hydration is observed <abbrgrp><abbr bid="B35">35</abbr></abbrgrp>, we found a completely different <it>aqp1b </it>expression pattern, together with a higher mutation rate in the amino acid sequence of the encoded protein. Based on these data, we argue that, in marine teleosts producing highly hydrated eggs, Aqp1b possibly represents a neofunctionalized water channel adapted to oocytes to facilitate water transport. Finn and Kristoffersen <abbrgrp><abbr bid="B7">7</abbr></abbrgrp> recently proposed that neofunctionalization of duplicated Vtg genes, which allowed one paralog to be proteolyzed into FAAs driving hydration of the maturing oocytes, was a key event in the evolution and success of the teleosts in the oceanic environment. The duplication and neofunctionalization of <it>aqp1b </it>may have occurred in parallel to this mechanism to facilitate oocyte water uptake in marine teleosts.</p>
         <p>The Aqp1b isoform found in freshwater teleosts that spawn non-hydrated eggs, such as zebrafish, might be inactivated by mutations, or be eventually lost in the genome. This hypothesis is supported by the absence of <it>aqp1b </it>in advanced freshwater species, such as medaka, while the synteny between the <it>aqp1a </it>chromosome loci and downstream genes (e.g., <it>thoc1</it>) is conserved. However, in other extant freshwater teleosts that arose later in evolution, such as <it>Tetraodon</it>, <it>aqp1b </it>is retained in the genome. The retention of <it>aqp1b </it>in freshwater pufferfishes is intriguing, given that there appears to have been a massive elimination of DNA after WGD in most modern teleost genomes, resulting in the retention of only a subset of the duplicates <abbrgrp><abbr bid="B36">36</abbr><abbr bid="B37">37</abbr></abbrgrp>. It is possible to speculate, however, that the recent evolution of Tetraodontiformes did not last long enough to allow specific divergence of the genome and hence of <it>aqp1b</it>. The relatively high amino acid sequence identity (77%) between fugu, a marine pufferfish which produces hydrated eggs, and <it>Tetraodon </it>Aqp1b supports this conjecture. In any event, additional studies aiming at the characterization of Aqp1b in more freshwater fish species, as well as the determination of sites of gene expression and protein accumulation, are required to better understand the driving force behind <it>aqp1b </it>isoform evolution.</p>
         <p>In addition to the ovary, <it>aqp1b </it>mRNA has been detected in the posterior intestine, kidney, gills and esophagus of marine fish (this work, and <abbrgrp><abbr bid="B10">10</abbr><abbr bid="B14">14</abbr><abbr bid="B38">38</abbr></abbrgrp>). The intestine of marine teleosts has an important osmoregulatory role, as hypo-osmoregulating fish have long been known to drink seawater to replace water lost by diffusion to their environment (see <abbrgrp><abbr bid="B39">39</abbr></abbrgrp> for review). Accordingly, Aqp1a and Aqp1b proteins have been reported to be localized in the intestinal epithelia of teleosts <abbrgrp><abbr bid="B12">12</abbr><abbr bid="B13">13</abbr><abbr bid="B14">14</abbr><abbr bid="B15">15</abbr></abbrgrp>. However, in the sea bream gastrointestinal tract Aqp1a and Aqp1b have a different distribution pattern. Whereas Aqp1a is localized in the apical and basolateral membrane of enterocytes in duodenum and hindgut, Aqp1b is exclusively localized in the apical microvilli of rectal epithelial cells <abbrgrp><abbr bid="B12">12</abbr></abbrgrp>. Moreover, freshwater acclimation reduces the synthesis of Aqp1a in all intestinal segments, and of Aqp1b in rectum. Conversely, seawater acclimation of eels increases Aqp1a expression and protein synthesis in the intestine <abbrgrp><abbr bid="B13">13</abbr><abbr bid="B19">19</abbr></abbrgrp>. Therefore, although the specific physiological functions of Aqp1a and Aqp1b in the teleost gastrointestinal tract remain unknown, these data may point to an additional role of Aqp1b in water movement across the intestinal epithelia.</p>
         <p>The primary structure of AQP1-like proteins corresponding to the TM2 and TM5 domains and connecting loops B and E, which are involved in the formation of the water-selective pore, is highly conserved between teleost and mammals. However, Aqp1a and Aqp1b show different permeability efficiencies when expressed in <it>X. laevis </it>oocytes, and teleost Aqp1b isoforms also show a marked structural divergence at the C-terminal cytoplasmic tail with respect to Aqp1a and mammalian AQP1. Functional experiments, using artificial expression in oocytes of sea bream wild-type Aqp1a and Aqp1b, and chimeric proteins in which the C-terminus of Aqp1a was totally exchanged for that of Aqp1b, or the reverse, revealed that the Aqp1a tail drives constitutive targeting to the plasma membrane, unlike that of Aqp1b which produces partial retention of the expressed proteins in intracelluar vesicles. These data strongly suggest that Aqp1b independently acquired specific regulatory domains in the C-terminal region for the control of Aqp1b intracellular trafficking.</p>
         <p>To investigate the nature of putative regulatory sites in the Aqp1b C-terminus, we analyzed its amino acid sequence in different teleosts. Based on this analysis, selected residues of sea bream Aqp1b were mutated into Ala or Asp and the resulting proteins were expressed in oocytes to determine their intracellular localization and permeability properties. In the Aqp1b C-terminus, we found typical sorting and internalisation signals that are common in many mammalian transmembrane proteins for targeting from the trans-Golgi network to the lysosomal-endosomal compartment <abbrgrp><abbr bid="B22">22</abbr></abbrgrp>. These motifs, however, were also detected in the Aqp1a C-terminal tail, although their sequence appeared to be different between the Aqp1a and Aqp1b isoforms. Thus, in all six teleost Aqp1b sequences analyzed, but not in Aqp1a, a di-Leu or Leu-Ile signals appear to be conserved. Mutation of sea bream Aqp1b Leu<sup>234</sup>Leu<sup>235 </sup>motif into Ala<sup>234</sup>Ala<sup>235 </sup>produced the retention of the protein in intracellular compartments and apparently increased its degradation, thereby reducing water permeability of these oocytes. These results are similar to those observed with the mammalian AQP2 mutant which has an altered and extended C-terminal tail, retained in late endosomes/lysosomes triggering degradation <abbrgrp><abbr bid="B40">40</abbr></abbrgrp>. Similarly, mutation of the C-terminal Leu<sup>345</sup>Leu<sup>346 </sup>motif in the human vasopressin V3 receptor produces mis-folding of the protein and abolishes receptor export <abbrgrp><abbr bid="B41">41</abbr></abbrgrp>. It is possible therefore, that the di-Leu motif in sea bream Aqp1b also plays a role in conformation, ensuring correct routing to the plasma membrane. However, di-Leu motifs are also involved in basolateral membrane targeting and microvilli anchoring of mammalian cell adhesion proteins, ion channels and receptors <abbrgrp><abbr bid="B42">42</abbr><abbr bid="B43">43</abbr><abbr bid="B44">44</abbr><abbr bid="B45">45</abbr></abbrgrp>, including AQP4 <abbrgrp><abbr bid="B46">46</abbr></abbrgrp>, in polarized epithelial cells. Further studies are needed to establish whether the di-Leu motif has an additional function in the control of Aqp1b expression on the cell surface.</p>
         <p>Most notably, functional analyses revealed that two residues in the sea bream Aqp1b C-terminal sequence, Thr<sup>229 </sup>and Ser<sup>254</sup>, were responsible for sea bream Aqp1b translocation from intracellular vesicles to the oocyte plasma membrane. The probability of the Thr<sup>229 </sup>residue being phosphorylated was low, and accordingly the Aqp1b-T229A mutant did not affect the phosphorylation state of Aqp1b, although it did inhibit Aqp1b cell surface expression and oocyte water permeability. Since Thr<sup>229 </sup>did not match any kinase phosphorylation consensus site other than protein kinase C (which apparently is not relevant here), the specific function of this residue is unknown and awaits further experimentation. Nevertheless, it was observed that the Aqp1b-S254A mutant prevented phosphorylation and increased Aqp1b translocation into the plasma membrane and subsequent water permeability, whereas the Aqp1b-S254D mutant, which mimicked the constitutively phosphorylated state of Aqp1b, was predominantly located in intracellular vesicles. These results suggest that dephosphorylation of Ser<sup>254 </sup>triggers Aqp1b shuttling to the cell surface, while its phosphorylation may retain the protein in intracellular vesicles. This mechanism is thus apparently the opposite to that described so far for mammalian and amphibian AQPs (i.e., AQP2 and AQP-h2), where channel insertion in the plasma membrane of collecting duct cells or granular cells of the anuran urinary bladder is triggered by protein kinase A-mediated phosphorylation of specific Ser residues in the C-terminal tail <abbrgrp><abbr bid="B21">21</abbr><abbr bid="B47">47</abbr></abbrgrp>. Interestingly, the Ser<sup>254 </sup>in sea bream Aqp1b, a consensus site for a Pro-directed kinase, seems to be conserved in modern marine teleosts which produce hydrated eggs (Ser<sup>244 </sup>in fugu Aqp1b and Ser<sup>244 </sup>in sole Aqp1b). Pro-directed kinases are a large family of mitogen-activated protein kinases (MAPK) and cyclin-dependent kinase-like kinases, some of which (e.g., p38 MAPK) are involved in transduction pathways leading to the activation of the maturation promoting factor (MPF) during oocyte meiotic maturation <abbrgrp><abbr bid="B48">48</abbr><abbr bid="B49">49</abbr><abbr bid="B50">50</abbr></abbrgrp>. In sea bream, Aqp1b translocation into the oocyte plasma membrane is a tightly regulated process thought to occur transiently downstream of MPF activation during meiotic maturation, just before complete hydrolysis of yolk proteins and maximum K<sup>+ </sup>accumulation is reached in the oocyte <abbrgrp><abbr bid="B11">11</abbr></abbrgrp>. Therefore, it will be of interest to investigate the potential role of cell-cycle related kinases, or other kinases activated during oocyte maturation, in Ser<sup>254 </sup>phosphorylation and regulation of Aqp1b trafficking.</p>
      </sec>
      <sec>
         <st>
            <p>Conclusion</p>
         </st>
         <p>We provide phylogenetic and functional evidence for the teleost lineage-specific duplication of AQP1 channels and further divergence at the C-terminal tail. The generation and neofunctionalization of the Aqp1b isoform in oocytes of marine teleosts most likely contributed with the production of highly hydrated eggs to ensure survival in seawater. The neofunctionalization of Aqp1b has also been accompanied by the acquisition of regulatory domains in the cytoplasmic C-terminal tail for the specific control of Aqp1b intracellular trafficking, which are currently being investigated. The elucidation of the biological functions of Aqp1a and Aqp1b in teleosts will contribute to our understanding of the evolution of phenotypic complexity, diversity and innovation in vertebrates.</p>
      </sec>
      <sec>
         <st>
            <p>Methods</p>
         </st>
         <sec>
            <st>
               <p>Animals</p>
            </st>
            <p>Adult zebrafish, gilthead sea bream, Senegalese sole, and European eel were purchased from local pet stores or fish farms and maintained as described <abbrgrp><abbr bid="B11">11</abbr><abbr bid="B51">51</abbr><abbr bid="B52">52</abbr><abbr bid="B53">53</abbr></abbrgrp>. Naturally spawning fish, or hormone-stimulated in the case of eel (see <abbrgrp><abbr bid="B53">53</abbr></abbrgrp> for details), were sedated by immersion for approximately 15 min in 100 ppm phenoxyethanol, sacrificed by decapitation, and samples of mature ovary and other tissues immediately dissected and frozen at -80&#176;C. Procedures relating to the care and use of animals were approved by the Ethics Committee from IRTA in accordance with the Guiding Principles for the Care and Use of Laboratory Animals.</p>
         </sec>
         <sec>
            <st>
               <p>Cloning and sequencing of teleost AQP1-like cDNAs</p>
            </st>
            <p>Partial cDNAs encoding European eel Aqp1b and Senegalese sole Aqp1a were isolated by reverse transcriptase-polymerase chain reaction (RT-PCR) employing degenerate oligonucleotide primers (see Additional file <supplr sid="S3">3</supplr>). Total RNA was extracted from kidney, intestine and hydrated ovaries using the RNeasy Maxikit (Qiagen), followed by polyA RNA purification with the Oligotex mRNA Minikit (Qiagen). PolyA RNA (500 ng) was reverse transcribed using 0.5 &#956;g oligo (dT)<sub>17</sub>, 1 mM dNTPs, 40 IU RNAse inhibitor (Roche), and 10 IU MMLuV-RT enzyme (Roche), for 1.5 h at 42&#176;C. The PCR was carried out with 0.5 &#956;l of the RT reaction in a volume of 50 &#956;l containing 1 &#215; PCR buffer plus Mg<sup>2+</sup>, 0.2 mM dNTPs, 0.2 &#956;M of each forward and reverse oligonucleotide primers, and 1 IU of Taq polymerase (Roche). Reactions were amplified using one cycle of 95&#176;C, 5 min; then 40 cycles of 95&#176;C, 30 sec; 54&#176;C, 30 sec; 72&#176;C, 1 min; and a final 7-min elongation at 72&#176;C. The products were cloned into the pGEM-T Easy Vector (Promega) and sequenced by BigDye Terminator version 3.1 cycle sequencing on ABI PRISM 377 DNA analyzer (Applied Biosystems). Full-length eel Aqp1b cDNA was isolated by rapid amplification of cDNA ends (RACE; Gibco) followed by a final amplification with a high-fidelity polymerase (Pwo; Roche). Full-length zebrafish Aqp1b cDNA was amplified from total RNA extracted from adult brain using specific forward and reverse primers based on a predicted cDNA (see Additional file <supplr sid="S3">3</supplr>). The nucleotide sequence of Senegalese sole Aqp1a, European eel Aqp1b, and zebrafish Aqp1b have been deposited in the GenBank database under accession numbers <ext-link ext-link-id="DQ889223" ext-link-type="gen">DQ889223</ext-link>, <ext-link ext-link-id="EF011738" ext-link-type="gen">EF011738</ext-link>, and <ext-link ext-link-id="EU327345" ext-link-type="gen">EU327345</ext-link>, respectively.</p>
            <suppl id="S3">
               <title>
                  <p>Additional file 3</p>
               </title>
               <text>
                  <p><b>Degenerate and gene- or cDNA-specific oligonucleotide primers used for cloning and RT-PCR analysis</b>. The table list the oligonucleotide primers employed for the cloning of teleost AQP1-like cDNAs and sea bream <it>aqp1a</it> and <it>aqp1b</it> loci, and for RT-PCR analyses of <it>aqp1b </it>gene expression.</p>
               </text>
               <file name="1471-2148-8-259-S3.pdf">
                  <p>Click here for file</p>
               </file>
            </suppl>
         </sec>
         <sec>
            <st>
               <p>Genomic organization of teleost <it>aqp1a </it>and <it>aqp1b </it>genes</p>
            </st>
            <p>Genomic sequences covering the complete sea bream <it>aqp1a </it>and <it>aqp1b </it>loci, as well as the flanking cassette, were amplified by PCR on liver-extracted genomic DNA using the Expand Long Template PCR system 3 (Roche) and gene specific primers (see Additional file <supplr sid="S3">3</supplr>). Products were cloned into the pGEM-T Easy Vector and sequenced as described. The nucleotide sequence of sea bream <it>aqp1a </it>and <it>aqp1b </it>loci have been deposited in the GenBank database under accession numbers <ext-link ext-link-id="EF011739" ext-link-type="gen">EF011739</ext-link> and <ext-link ext-link-id="EF011740" ext-link-type="gen">EF011740</ext-link>, respectively. Zebrafish, medaka, fugu, pufferfish, and three-spined stickleback <it>aqp1a </it>and <it>aqp1b </it>genomic sequences were retrieved from ENSEMBL <abbrgrp><abbr bid="B54">54</abbr></abbrgrp>. The exon-intron structure was determined from cloned cDNAs and available ESTs.</p>
         </sec>
         <sec>
            <st>
               <p>Phylogenetic and sequence analyses</p>
            </st>
            <p>Vertebrate and teleost MIP sequences were retrieved from the NCBI database <abbrgrp><abbr bid="B55">55</abbr></abbrgrp> and ENSEMBL and analyzed at the amino acid level. Amino acid sequence alignments were performed using the ClustalW multiple sequence alignment program <abbrgrp><abbr bid="B56">56</abbr></abbrgrp> employing the sequence from the first NPA motif to the start of the C-terminus (when sequence data was available), and were manually optimized using the Bioedit software <abbrgrp><abbr bid="B57">57</abbr></abbrgrp>. The alignment is shown in the Additional file <supplr sid="S1">1</supplr>. The phylogenetic tree and branch support values were estimated by using the NJ, ML and BI methodologies of phylogenetic reconstruction. The NJ analysis <abbrgrp><abbr bid="B58">58</abbr></abbrgrp> of the amino acid alignment was based on mean character distances using Mega3 software <abbrgrp><abbr bid="B59">59</abbr></abbrgrp>; bootstrap support values were obtained with 1,000 repetitions. For ML and BI analyses, a Bayesian consensus tree for the sequence data set was built and used to estimate the best-fit evolutionary model by using ProtTest v1.4 <abbrgrp><abbr bid="B60">60</abbr></abbrgrp>. Then, ML (including bootstrapping) analysis was performed with PhyML <abbrgrp><abbr bid="B61">61</abbr></abbrgrp>. To confirm the ML tree, a BI (including posterior probabilities) of phylogeny was conducted by using MrBAYES v3.1 <abbrgrp><abbr bid="B62">62</abbr></abbrgrp> with the ProtTest best-fit model of amino acid substitution (CpRev) provided in the package. Four independent runs, each with four simultaneous Markov Chain Monte Carlo chains, were performed for 1,000,000 generations sampled every 100 generations. Potential Ser, Thr and Tyr phosphorylation sites in amino acid sequences were predicted using NetPhos 2.0 <abbrgrp><abbr bid="B63">63</abbr></abbrgrp>. Candidate functional sites were identified using the Eukaryotic Linear Motif (ELM) server <abbrgrp><abbr bid="B64">64</abbr></abbrgrp>.</p>
         </sec>
         <sec>
            <st>
               <p>Gene expression analysis</p>
            </st>
            <p>The abundance of <it>aqp1b </it>transcripts in sea bream, eel, Senegalese sole and zebrafish adult tissues was assessed by conventional RT-PCR followed by Southern blot. Total RNA from liver, intestine, kidney, gills, brain, ovary and testis was extracted, treated with DNase, and first-strand cDNA synthesized as described above. The PCR was carried out as above on 1 &#956;l of the RT reaction using species-specific <it>aqp1b </it>forward and reverse oligonucleotide primers located in exon 3 and 4, respectively (see Additional file <supplr sid="S3">3</supplr>). For zebrafish, 500 ng of DNA template was also amplified using the corresponding oligos (not shown). In all experiments, &#946;-actin was used as a reference gene; forward and reverse oligonucleotide primers designed in highly conserved regions of zebrafish &#946;-actin1 (<it>bactin1</it>) (Additional file <supplr sid="S3">3</supplr>) were employed for all species. PCR reactions were performed with an initial cycle of 95&#176;C, 5 min; then variable number of cycles and temperatures for amplification, depending on the species, to generate half-maximal amounts of PCR products (not shown); and a final 7-min elongation at 72&#176;C. For sea bream aqp1b, the cycles were 28 of 95&#176;C, 30 sec; 62&#176;C, 30 sec; 72&#176;C, 30 sec; for eel and Senegal sole <it>aqp1b </it>the cycles were 37 and 36, respectively, of 95&#176;C, 1 min; 60&#176;C, 1 min; 72&#176;C, 1 min; and for zebrafish <it>aqp1b </it>the cycles were 35 of 95&#176;C, 1 min; 65&#176;C, 1 min; 72&#176;C, 1 min. For <it>bactin1 </it>the cycles were 26 for sea bream and eel, 24 for sole, and 22 for zebrafish, of 95&#176;C, 30 sec; 52&#176;C, 30 sec; 72&#176;C, 45 sec. The PCR products were electrophoresed on 1% agarose gels, and the DNA blotted to nylon membranes (Amersham). Membranes were hybridized with species-specific digoxigenin-labelled <it>aqp1b </it>probes using the DIG DNA Labelling Mix (Roche).</p>
         </sec>
         <sec>
            <st>
               <p>Expression constructs</p>
            </st>
            <p>Sea bream Aqp1a and Aqp1b, and zebrafish, eel and Senegalese sole Aqp1b were cloned into the EcoRV/SpeI sites of the oocyte expression vector pT7Ts <abbrgrp><abbr bid="B63">63</abbr></abbrgrp>. To obtain the Aqp1a-Ct1b, in which the C-terminus of Aqp1a was replaced by that of Aqp1b, the C-terminus-coding nucleotide sequence of Aqp1b was PCR amplified using a forward primer partially complementary to Aqp1a, 5'-CCCCCAAATTCCAAAACTTCAGGACGCGCAG-3', and a reverse primer bearing a SpeI restriction site, 5'-ACTAGTGCTTGTTTTTTCAGTGCTTTGG-3'. In parallel, a fragment of Aqp1a cDNA lacking the nucleotide sequence encoding the C-terminus was amplified using a forward primer specific to the 5' end of Aqp1a with an EcoRV site, 5'-GATATCGCCACCACCATGAGAGAG-3', and a reverse primer partially complementary to the nucleotide sequence of the C-terminus of Aqp1b, 5'-GAAGTTTTGGAATTTGGGGGACAG-3'. After purification, the two PCR products were used as templates to synthesize Aqp1a-Ct1b employing the forward and reverse primers bearing EcoRV and SpeI, respectively. The Aqp1b-Ct1a chimera, in which the C-terminus of Aqp1b was replaced by that of Aqp1a, was obtained by amplifying the C-terminus-coding nucleotide sequence of Aqp1a with the primers 5'-CACGAGCGGACGACTTCCCCGAGCGC-3' and 5'-ACTAGTCGTCTGTGTGGGACTATTTTGACG-3'. The Aqp1b-Ct1a cDNA was then amplified using the PCR product as reverse primer and a forward primer specific to the 5' end of Aqp1b, with an EcoRV site (5'-GATATCTCGACGCGGAGATGACAGAA-3'), employing full-length Aqp1b cDNA as a template. In all cases, PCR reactions were performed using Pwo or Easy-A high-fidelity polymerases (Stratagene), and the chimera cDNAs were ligated into pT7Ts after digestion with EcoRV and SpeI. Mutations into the sea bream Aqp1b C-terminal amino acid sequence were introduced by using the QuickChange site-directed mutagenesis kit (Stratagene) on pT7Ts-Aqp1b (Additional file <supplr sid="S4">4</supplr>). Sequence analysis of selected clones was carried out to confirm that only the desired chimeras or mutations were produced.</p>
            <suppl id="S4">
               <title>
                  <p>Additional file 4</p>
               </title>
               <text>
                  <p><b>Forward and reverse primers employed to introduce mutations into the sea bream Aqp1b cDNA</b>. The table lists the oligonucelotide primers employed for the site-directed mutagenesis of the sea bream Aqp1b cDNA.</p>
               </text>
               <file name="1471-2148-8-259-S4.pdf">
                  <p>Click here for file</p>
               </file>
            </suppl>
         </sec>
         <sec>
            <st>
               <p>Functional expression of teleost AQPs in <it>Xenopus laevis </it>oocytes</p>
            </st>
            <p>Complementary RNA (cRNA) synthesis, expression in <it>X. laevis </it>oocytes, and <it>P</it><sub>f </sub>measurements were performed essentially as described <abbrgrp><abbr bid="B65">65</abbr></abbrgrp>. Oocytes were injected with 0.25 to 10 ng cRNA. The swelling assays were carried out in 10-fold diluted modified Barth's solution (MBS: 88 mM NaCl, 1 mM KCl, 2.4 mM NaHCO<sub>3</sub>, 10 mM Hepes, pH 7.5, 0.82 mM MgSO<sub>4</sub>, 0.33 mM Ca(NO<sub>3</sub>)<sub>2</sub>, 0.41 mM CaCl<sub>2</sub>, and 25 &#956;g/ml gentamicin) in the presence or absence of 0.7 mM HgCl<sub>2 </sub>and 5 mM &#946;-mercaptoethanol. The data shown are an average of 3&#8211;5 experiments (each with different batches of oocytes), or from a representative experiment out of three different trials producing similar results. The measured <it>P</it><sub>f </sub>values were statistically analyzed in an unpaired Student's <it>t </it>test; <it>p </it>values &lt; 0.05 were considered significantly different.</p>
         </sec>
         <sec>
            <st>
               <p>Western blotting and immunofluorescence microscopy</p>
            </st>
            <p>Total and plasma membranes were isolated from groups of 10 oocytes as described <abbrgrp><abbr bid="B66">66</abbr></abbrgrp>. Protein samples were denatured at 95&#176;C for 5 min in Laemmli buffer, electrophoresed on a 12% polyacrylamide SDS gel and then blotted onto PVDF or nitrocellulose membranes (Bio-Rad Laboratories). Membranes were blocked for 1 h with TBST (20 mM Tris, 140 mM NaCl, 0.1% Tween, pH 7.6) containing 1% nonfat dry milk, and then incubated with 1:300 diluted affinity-purified rabbit antisera against sea bream Aqp1a or Aqp1b in TBST with 1% nonfat milk powder at 4&#176;C overnight. The Aqp1a and Aqp1b antisera were produced against synthetic peptides corresponding to the C-terminus of the corresponding proteins and they have been characterized elsewhere <abbrgrp><abbr bid="B10">10</abbr><abbr bid="B11">11</abbr><abbr bid="B12">12</abbr></abbrgrp>. As secondary antibody, a 1:8000 dilution of goat anti-rabbit IgG coupled to horseradish peroxidase (Sigma) was used. Reactive protein bands were detected using enhanced chemiluminescence (Amersham). In some experiments, protein dephosphorylation was carried out before SDS-PAGE by resuspending total membrane extracts of Aqp1b-expressing oocytes in 10 mM MgCl<sub>2</sub>, 10 mM Tris-HCl, pH 7.5 and treating with calf intestinal alkaline phosphatase (Fermentas) for 6 h at 37&#176;C, following the manufacturer's instructions.</p>
            <p>Immunofluorescence microscopy was carried out on Aqp1a- and Aqp1b-expressing oocytes fixed in Bouin's without acetic acid for 4 h, subsequently dehydrated and embedded in paraplast (Sigma). Sections (7 &#956;m) were blocked with 5% goat serum in PBST (137 mM NaCl, 2.7 mM KCl, 4.3 mM Na<sub>2</sub>HPO<sub>4</sub>, 1.4 mM KH<sub>2</sub>PO<sub>4</sub>, 1% BSA, 0.01% Tween, pH 7.5), and incubated at 4&#176;C overnight with Aqp1a or Aqp1b antisera (1:100) in PBST with 1% goat serum. Bound antibodies were detected with mouse FITC anti-rabbit secondary antibodies (1:300). Sections were mounted with Vectashield (Vector Labs) or Prolong Gold antifade reagent (Invitrogen) and photos taken using a Leica SP2 confocal laser scanning microscope.</p>
         </sec>
      </sec>
      <sec>
         <st>
            <p>Abbreviations</p>
         </st>
         <p>MIP: Membrane intrinsic protein; AQP: Aquaporin; FAAs: Free amino acids; Vtg: Vitellogenin; SaAQP1o: <it>Sparus aurata </it>aquaporin-1o (now termed Aqp1b); SaAQP1: <it>S. aurata </it>aquaporin-1 (now termed Aqp1a); EST: Expressed sequence tag; NJ: Neighbour-joining; ML: Maximum likelihood; BI: Bayesian inference; <it>P</it><sub>f</sub>: Osmotic water permeability; CK1: Casein kinase 1; CK2: Casein kinase 2; WGD: Whole-genome duplication; MAPK: Mitogen-activated protein kinase; MPF: Maturation promoting factor.</p>
      </sec>
      <sec>
         <st>
            <p>Authors' contributions</p>
         </st>
         <p>ATS carried out the cDNA cloning and the genomic and expression analyses, and the drafting of the manuscript. ATS, FC and MF performed the mutation experiments in oocytes and Western blotting. ATS and JL carried out the phylogenetic analyses, and DR was involved in immunocytochemical experiments. JC conceived and designed the study, contributed to coordination of tasks, and prepared the final version of the manuscript. All authors read and approved the final manuscript.</p>
      </sec>
   </bdy>
   <bm>
      <ack>
         <sec>
            <st>
               <p>Acknowledgements</p>
            </st>
            <p>This work was supported by grants from the Spanish Ministry of Education and Science (MEC, Spain; AGL2004-00316 and AGL2007-60262) and the European Commission (Q5RS-2002-00784-CRYOCYTE) to JC. Participations of FC, MF and DR were supported by the European Commission (Marie Curie Research Training Network Aqua(glycero)porins, MRTN-CT-2006-035995), a predoctoral scholarship from the Departament d'Universitats, Recerca i Societat de la Informaci&#243; (Catalan Government, Spain), and by a Ram&#243;n y Cajal contract (MEC, Spain).</p>
         </sec>
      </ack>
      <refgrp>
         <bibl id="B1">
            <title>
               <p>From structure to disease: the evolving tale of aquaporin biology</p>
            </title>
            <aug>
               <au>
                  <snm>King</snm>
                  <fnm>LS</fnm>
               </au>
               <au>
                  <snm>Kozono</snm>
                  <fnm>D</fnm>
               </au>
               <au>
                  <snm>Agre</snm>
                  <fnm>P</fnm>
               </au>
            </aug>
            <source>Nat Rev Mol Cell Biol</source>
            <pubdate>2004</pubdate>
            <volume>5</volume>
            <fpage>687</fpage>
            <lpage>698</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1038/nrm1469</pubid>
                  <pubid idtype="pmpid" link="fulltext">15340377</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B2">
            <title>
               <p>Structure and function of water channels</p>
            </title>
            <aug>
               <au>
                  <snm>Fujiyoshi</snm>
                  <fnm>Y</fnm>
               </au>
               <au>
                  <snm>Mitsuoka</snm>
                  <fnm>K</fnm>
               </au>
               <au>
                  <snm>de Groot</snm>
                  <fnm>BL</fnm>
               </au>
               <au>
                  <snm>Philippsen</snm>
                  <fnm>A</fnm>
               </au>
               <au>
                  <snm>Grubmuller</snm>
                  <fnm>H</fnm>
               </au>
               <au>
                  <snm>Agre</snm>
                  <fnm>P</fnm>
               </au>
               <au>
                  <snm>Engel</snm>
                  <fnm>A</fnm>
               </au>
            </aug>
            <source>Curr Opin Struct Biol</source>
            <pubdate>2002</pubdate>
            <volume>12</volume>
            <fpage>509</fpage>
            <lpage>515</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1016/S0959-440X(02)00355-X</pubid>
                  <pubid idtype="pmpid" link="fulltext">12163075</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B3">
            <title>
               <p>Aquaporins: water channel proteins of the cell membrane</p>
            </title>
            <aug>
               <au>
                  <snm>Takata</snm>
                  <fnm>K</fnm>
               </au>
               <au>
                  <snm>Matsuzaki</snm>
                  <fnm>T</fnm>
               </au>
               <au>
                  <snm>Tajika</snm>
                  <fnm>Y</fnm>
               </au>
            </aug>
            <source>Prog Histochem Cytochem</source>
            <pubdate>2004</pubdate>
            <volume>39</volume>
            <fpage>1</fpage>
            <lpage>83</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1016/j.proghi.2004.03.001</pubid>
                  <pubid idtype="pmpid">15242101</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B4">
            <title>
               <p>Aquaporins in the kidney: from molecules to medicine</p>
            </title>
            <aug>
               <au>
                  <snm>Nielsen</snm>
                  <fnm>S</fnm>
               </au>
               <au>
                  <snm>Frokiaer</snm>
                  <fnm>J</fnm>
               </au>
               <au>
                  <snm>Marples</snm>
                  <fnm>D</fnm>
               </au>
               <au>
                  <snm>Kwon</snm>
                  <fnm>TH</fnm>
               </au>
               <au>
                  <snm>Agre</snm>
                  <fnm>P</fnm>
               </au>
               <au>
                  <snm>Knepper</snm>
                  <fnm>MA</fnm>
               </au>
            </aug>
            <source>Physiol Rev</source>
            <pubdate>2002</pubdate>
            <volume>82</volume>
            <fpage>205</fpage>
            <lpage>244</lpage>
            <xrefbib>
               <pubid idtype="pmpid" link="fulltext">11773613</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B5">
            <title>
               <p>Three distinct roles of aquaporin-4 in brain function revealed by knockout mice</p>
            </title>
            <aug>
               <au>
                  <snm>Verkman</snm>
                  <fnm>AS</fnm>
               </au>
               <au>
                  <snm>Binder</snm>
                  <fnm>DK</fnm>
               </au>
               <au>
                  <snm>Bloch</snm>
                  <fnm>O</fnm>
               </au>
               <au>
                  <snm>Auguste</snm>
                  <fnm>K</fnm>
               </au>
               <au>
                  <snm>Papadopoulos</snm>
                  <fnm>MC</fnm>
               </au>
            </aug>
            <source>Biochim Biophys Acta</source>
            <pubdate>2006</pubdate>
            <volume>1758</volume>
            <fpage>1085</fpage>
            <lpage>1093</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1016/j.bbamem.2006.02.018</pubid>
                  <pubid idtype="pmpid" link="fulltext">16564496</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B6">
            <title>
               <p>Physiological roles of glycerol-transporting aquaporins: the aquaglyceroporins</p>
            </title>
            <aug>
               <au>
                  <snm>Hara-Chikuma</snm>
                  <fnm>M</fnm>
               </au>
               <au>
                  <snm>Verkman</snm>
                  <fnm>AS</fnm>
               </au>
            </aug>
            <source>Cell Mol Life Sci</source>
            <pubdate>2006</pubdate>
            <volume>63</volume>
            <fpage>1386</fpage>
            <lpage>1392</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1007/s00018-006-6028-4</pubid>
                  <pubid idtype="pmpid" link="fulltext">16715408</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B7">
            <title>
               <p>Vertebrate vitellogenin gene duplication in relation to the "3R hypothesis": correlation to the pelagic egg and the oceanic radiation of teleosts</p>
            </title>
            <aug>
               <au>
                  <snm>Finn</snm>
                  <fnm>RN</fnm>
               </au>
               <au>
                  <snm>Kristoffersen</snm>
                  <fnm>BA</fnm>
               </au>
            </aug>
            <source>PLoS ONE</source>
            <pubdate>2007</pubdate>
            <volume>2</volume>
            <fpage>e169</fpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">1770952</pubid>
                  <pubid idtype="pmpid" link="fulltext">17245445</pubid>
                  <pubid idtype="doi">10.1371/journal.pone.0000169</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B8">
            <title>
               <p>Yolk protein hydrolysis and oocyte free amino acids as key feature in the adaptive evolution of teleost fishes to seawater</p>
            </title>
            <aug>
               <au>
                  <snm>Fyhn</snm>
                  <fnm>HJ</fnm>
               </au>
               <au>
                  <snm>Finn</snm>
                  <fnm>RN</fnm>
               </au>
               <au>
                  <snm>Reith</snm>
                  <fnm>M</fnm>
               </au>
               <au>
                  <snm>Norberg</snm>
                  <fnm>B</fnm>
               </au>
            </aug>
            <source>Sarsia</source>
            <pubdate>1999</pubdate>
            <volume>84</volume>
            <fpage>451</fpage>
            <lpage>456</lpage>
         </bibl>
         <bibl id="B9">
            <title>
               <p>Physiological and molecular basis of fish oocyte hydration</p>
            </title>
            <aug>
               <au>
                  <snm>Cerd&#224;</snm>
                  <fnm>J</fnm>
               </au>
               <au>
                  <snm>Fabra</snm>
                  <fnm>M</fnm>
               </au>
               <au>
                  <snm>Rald&#250;a</snm>
                  <fnm>D</fnm>
               </au>
            </aug>
            <source>The Fish Oocyte: From Basic Studies to Biotechnological Applications</source>
            <publisher>Springer, The Netherlands</publisher>
            <editor>Babin PJ, Cerd&#224; J, Lubzens E</editor>
            <pubdate>2007</pubdate>
            <fpage>349</fpage>
            <lpage>396</lpage>
         </bibl>
         <bibl id="B10">
            <title>
               <p>Marine fish egg hydration is aquaporin-mediated</p>
            </title>
            <aug>
               <au>
                  <snm>Fabra</snm>
                  <fnm>M</fnm>
               </au>
               <au>
                  <snm>Rald&#250;a</snm>
                  <fnm>D</fnm>
               </au>
               <au>
                  <snm>Power</snm>
                  <fnm>DM</fnm>
               </au>
               <au>
                  <snm>Deen</snm>
                  <fnm>PMT</fnm>
               </au>
               <au>
                  <snm>Cerd&#224;</snm>
                  <fnm>J</fnm>
               </au>
            </aug>
            <source>Science</source>
            <pubdate>2005</pubdate>
            <volume>307</volume>
            <fpage>545</fpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1126/science.1106305</pubid>
                  <pubid idtype="pmpid" link="fulltext">15681377</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B11">
            <title>
               <p>Yolk proteolysis and aquaporin-1o play essential roles to regulate fish oocyte hydration during meiosis resumption</p>
            </title>
            <aug>
               <au>
                  <snm>Fabra</snm>
                  <fnm>M</fnm>
               </au>
               <au>
                  <snm>Rald&#250;a</snm>
                  <fnm>D</fnm>
               </au>
               <au>
                  <snm>Bozzo</snm>
                  <fnm>MG</fnm>
               </au>
               <au>
                  <snm>Deen</snm>
                  <fnm>PMT</fnm>
               </au>
               <au>
                  <snm>Lubzens</snm>
                  <fnm>E</fnm>
               </au>
               <au>
                  <snm>Cerd&#224;</snm>
                  <fnm>J</fnm>
               </au>
            </aug>
            <source>Dev Biol</source>
            <pubdate>2006</pubdate>
            <volume>295</volume>
            <fpage>250</fpage>
            <lpage>262</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1016/j.ydbio.2006.03.034</pubid>
                  <pubid idtype="pmpid" link="fulltext">16643885</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B12">
            <title>
               <p>Differential localization and regulation of two aquaporin-1 homologs in the intestinal epithelia of the marine teleost Sparus aurata</p>
            </title>
            <aug>
               <au>
                  <snm>Rald&#250;a</snm>
                  <fnm>D</fnm>
               </au>
               <au>
                  <snm>Otero</snm>
                  <fnm>D</fnm>
               </au>
               <au>
                  <snm>Fabra</snm>
                  <fnm>M</fnm>
               </au>
               <au>
                  <snm>Cerd&#224;</snm>
                  <fnm>J</fnm>
               </au>
            </aug>
            <source>Am J Physiol Regul Integr Comp Physiol</source>
            <pubdate>2008</pubdate>
            <volume>294</volume>
            <fpage>R993</fpage>
            <lpage>R1003</lpage>
            <xrefbib>
               <pubid idtype="pmpid" link="fulltext">18171690</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B13">
            <title>
               <p>Intestinal water absorption through aquaporin 1 expressed in the apical membrane of mucosal epithelial cells in seawater-adapted Japanese eel</p>
            </title>
            <aug>
               <au>
                  <snm>Aoki</snm>
                  <fnm>M</fnm>
               </au>
               <au>
                  <snm>Kaneko</snm>
                  <fnm>T</fnm>
               </au>
               <au>
                  <snm>Katoh</snm>
                  <fnm>F</fnm>
               </au>
               <au>
                  <snm>Hasegawa</snm>
                  <fnm>S</fnm>
               </au>
               <au>
                  <snm>Tsutsui</snm>
                  <fnm>N</fnm>
               </au>
               <au>
                  <snm>Aida</snm>
                  <fnm>K</fnm>
               </au>
            </aug>
            <source>J Exp Biol</source>
            <pubdate>2003</pubdate>
            <volume>206</volume>
            <fpage>3495</fpage>
            <lpage>3505</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1242/jeb.00579</pubid>
                  <pubid idtype="pmpid" link="fulltext">12939380</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B14">
            <title>
               <p>Cloning and expression of three aquaporin homologues from the European eel (<it>Anguilla anguilla</it>): effects of seawater acclimation and cortisol treatment on renal expression</p>
            </title>
            <aug>
               <au>
                  <snm>Mart&#237;nez</snm>
                  <fnm>AS</fnm>
               </au>
               <au>
                  <snm>Cutler</snm>
                  <fnm>CP</fnm>
               </au>
               <au>
                  <snm>Wilson</snm>
                  <fnm>GD</fnm>
               </au>
               <au>
                  <snm>Phillips</snm>
                  <fnm>C</fnm>
               </au>
               <au>
                  <snm>Hazon</snm>
                  <fnm>N</fnm>
               </au>
               <au>
                  <snm>Cramb</snm>
                  <fnm>G</fnm>
               </au>
            </aug>
            <source>Biol Cell</source>
            <pubdate>2005</pubdate>
            <volume>97</volume>
            <fpage>615</fpage>
            <lpage>627</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1042/BC20040111</pubid>
                  <pubid idtype="pmpid" link="fulltext">15850452</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B15">
            <title>
               <p>Aquaporin molecular characterization in the sea-bass (<it>Dicentrarchus labrax</it>): the effect of salinity on AQP1 and AQP3 expression</p>
            </title>
            <aug>
               <au>
                  <snm>Giffard-Mena</snm>
                  <fnm>I</fnm>
               </au>
               <au>
                  <snm>Boulo</snm>
                  <fnm>V</fnm>
               </au>
               <au>
                  <snm>Aujoulat</snm>
                  <fnm>F</fnm>
               </au>
               <au>
                  <snm>Fowden</snm>
                  <fnm>H</fnm>
               </au>
               <au>
                  <snm>Castille</snm>
                  <fnm>R</fnm>
               </au>
               <au>
                  <snm>Charmantier</snm>
                  <fnm>G</fnm>
               </au>
               <au>
                  <snm>Cramb</snm>
                  <fnm>G</fnm>
               </au>
            </aug>
            <source>Comp Biochem Physiol A Mol Integr Physiol</source>
            <pubdate>2007</pubdate>
            <volume>148</volume>
            <fpage>430</fpage>
            <lpage>444</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1016/j.cbpa.2007.06.002</pubid>
                  <pubid idtype="pmpid" link="fulltext">17618150</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B16">
            <title>
               <p>The Zebrafish Information Network (ZFIN): the zebrafish model organism database</p>
            </title>
            <aug>
               <au>
                  <snm>Sprague</snm>
                  <fnm>J</fnm>
               </au>
               <au>
                  <snm>Clements</snm>
                  <fnm>D</fnm>
               </au>
               <au>
                  <snm>Conlin</snm>
                  <fnm>T</fnm>
               </au>
               <au>
                  <snm>Edwards</snm>
                  <fnm>P</fnm>
               </au>
               <au>
                  <snm>Frazer</snm>
                  <fnm>K</fnm>
               </au>
               <au>
                  <snm>Schaper</snm>
                  <fnm>K</fnm>
               </au>
               <au>
                  <snm>Segerdell</snm>
                  <fnm>E</fnm>
               </au>
               <au>
                  <snm>Song</snm>
                  <fnm>P</fnm>
               </au>
               <au>
                  <snm>Sprunger</snm>
                  <fnm>B</fnm>
               </au>
               <au>
                  <snm>Westerfield</snm>
                  <fnm>M</fnm>
               </au>
            </aug>
            <source>Nucleic Acids Res</source>
            <pubdate>2003</pubdate>
            <volume>31</volume>
            <fpage>241</fpage>
            <lpage>243</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">165474</pubid>
                  <pubid idtype="pmpid" link="fulltext">12519991</pubid>
                  <pubid idtype="doi">10.1093/nar/gkg027</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B17">
            <title>
               <p>Structural basis of water-specific transport through the AQP1 water channel</p>
            </title>
            <aug>
               <au>
                  <snm>Sui</snm>
                  <fnm>H</fnm>
               </au>
               <au>
                  <snm>Han</snm>
                  <fnm>BG</fnm>
               </au>
               <au>
                  <snm>Lee</snm>
                  <fnm>JK</fnm>
               </au>
               <au>
                  <snm>Walian</snm>
                  <fnm>P</fnm>
               </au>
               <au>
                  <snm>Jap</snm>
                  <fnm>BK</fnm>
               </au>
            </aug>
            <source>Nature</source>
            <pubdate>2001</pubdate>
            <volume>414</volume>
            <fpage>872</fpage>
            <lpage>878</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1038/414872a</pubid>
                  <pubid idtype="pmpid" link="fulltext">11780053</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B18">
            <title>
               <p>The mercury-sensitive residue at cysteine 189 in the CHIP28 water channel</p>
            </title>
            <aug>
               <au>
                  <snm>Preston</snm>
                  <fnm>GM</fnm>
               </au>
               <au>
                  <snm>Jung</snm>
                  <fnm>JS</fnm>
               </au>
               <au>
                  <snm>Guggino</snm>
                  <fnm>WB</fnm>
               </au>
               <au>
                  <snm>Agre</snm>
                  <fnm>P</fnm>
               </au>
            </aug>
            <source>J Biol Chem</source>
            <pubdate>1993</pubdate>
            <volume>268</volume>
            <fpage>17</fpage>
            <lpage>20</lpage>
            <xrefbib>
               <pubid idtype="pmpid" link="fulltext">7677994</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B19">
            <title>
               <p>Regulation of expression of two aquaporin homologs in the intestine of the European eel: effects of seawater acclimation and cortisol treatment</p>
            </title>
            <aug>
               <au>
                  <snm>Mart&#237;nez</snm>
                  <fnm>AS</fnm>
               </au>
               <au>
                  <snm>Cutler</snm>
                  <fnm>CP</fnm>
               </au>
               <au>
                  <snm>Wilson</snm>
                  <fnm>GD</fnm>
               </au>
               <au>
                  <snm>Phillips</snm>
                  <fnm>C</fnm>
               </au>
               <au>
                  <snm>Hazon</snm>
                  <fnm>N</fnm>
               </au>
               <au>
                  <snm>Cramb</snm>
                  <fnm>G</fnm>
               </au>
            </aug>
            <source>Am J Physiol Regul Integr Comp Physiol</source>
            <pubdate>2005</pubdate>
            <volume>288</volume>
            <fpage>R1733</fpage>
            <lpage>R1743</lpage>
            <xrefbib>
               <pubid idtype="pmpid" link="fulltext">15650119</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B20">
            <title>
               <p>Routing of the aquaporin-2 water channel in health and disease</p>
            </title>
            <aug>
               <au>
                  <snm>Deen</snm>
                  <fnm>PM</fnm>
               </au>
               <au>
                  <snm>van Balkom</snm>
                  <fnm>BW</fnm>
               </au>
               <au>
                  <snm>Kamsteeg</snm>
                  <fnm>EJ</fnm>
               </au>
            </aug>
            <source>Eur J Cell Biol</source>
            <pubdate>2000</pubdate>
            <volume>79</volume>
            <fpage>523</fpage>
            <lpage>530</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1078/0171-9335-00075</pubid>
                  <pubid idtype="pmpid">11001488</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B21">
            <title>
               <p>Immunocytochemical studies on translocation of phosphorylated aquaporin-h2 protein in granular cells of the frog urinary bladder before and after stimulation with vasotocin</p>
            </title>
            <aug>
               <au>
                  <snm>Hasegawa</snm>
                  <fnm>T</fnm>
               </au>
               <au>
                  <snm>Suzuki</snm>
                  <fnm>M</fnm>
               </au>
               <au>
                  <snm>Tanaka</snm>
                  <fnm>S</fnm>
               </au>
            </aug>
            <source>Cell Tissue Res</source>
            <pubdate>2005</pubdate>
            <volume>322</volume>
            <fpage>407</fpage>
            <lpage>415</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1007/s00441-005-0037-8</pubid>
                  <pubid idtype="pmpid" link="fulltext">16047161</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B22">
            <title>
               <p>Signals for sorting of transmembrane proteins to endosomes and lysosomes</p>
            </title>
            <aug>
               <au>
                  <snm>Bonifacino</snm>
                  <fnm>JS</fnm>
               </au>
               <au>
                  <snm>Traub</snm>
                  <fnm>LM</fnm>
               </au>
            </aug>
            <source>Annu Rev Biochem</source>
            <pubdate>2003</pubdate>
            <volume>72</volume>
            <fpage>395</fpage>
            <lpage>447</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1146/annurev.biochem.72.121801.161800</pubid>
                  <pubid idtype="pmpid" link="fulltext">12651740</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B23">
            <title>
               <p>Docking sites on substrate proteins direct extracellular signal-regulated kinase to phosphorylate specific residues</p>
            </title>
            <aug>
               <au>
                  <snm>Fantz</snm>
                  <fnm>DA</fnm>
               </au>
               <au>
                  <snm>Jacobs</snm>
                  <fnm>D</fnm>
               </au>
               <au>
                  <snm>Glossip</snm>
                  <fnm>D</fnm>
               </au>
               <au>
                  <snm>Kornfeld</snm>
                  <fnm>K</fnm>
               </au>
            </aug>
            <source>J Biol Chem</source>
            <pubdate>2001</pubdate>
            <volume>276</volume>
            <fpage>27256</fpage>
            <lpage>27265</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1074/jbc.M102512200</pubid>
                  <pubid idtype="pmpid" link="fulltext">11371562</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B24">
            <title>
               <p>Crystal structures of MAP kinase p38 complexed to the docking sites on its nuclear substrate MEF2A and activator MKK3b</p>
            </title>
            <aug>
               <au>
                  <snm>Chang</snm>
                  <fnm>CI</fnm>
               </au>
               <au>
                  <snm>Xu</snm>
                  <fnm>BE</fnm>
               </au>
               <au>
                  <snm>Akella</snm>
                  <fnm>R</fnm>
               </au>
               <au>
                  <snm>Cobb</snm>
                  <fnm>MH</fnm>
               </au>
               <au>
                  <snm>Goldsmith</snm>
                  <fnm>EJ</fnm>
               </au>
            </aug>
            <source>Mol Cell</source>
            <pubdate>2002</pubdate>
            <volume>9</volume>
            <fpage>1241</fpage>
            <lpage>1249</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1016/S1097-2765(02)00525-7</pubid>
                  <pubid idtype="pmpid" link="fulltext">12086621</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B25">
            <title>
               <p>Phylogeny and evolution of the major intrinsic protein family</p>
            </title>
            <aug>
               <au>
                  <snm>Zardoya</snm>
                  <fnm>R</fnm>
               </au>
            </aug>
            <source>Biol Cell</source>
            <pubdate>2005</pubdate>
            <volume>97</volume>
            <fpage>397</fpage>
            <lpage>414</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1042/BC20040134</pubid>
                  <pubid idtype="pmpid" link="fulltext">15850454</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B26">
            <title>
               <p>Basal actinopterygian relationships: a mitogenomic perspective on the phylogeny of the "ancient fish"</p>
            </title>
            <aug>
               <au>
                  <snm>Inoue</snm>
                  <fnm>JG</fnm>
               </au>
               <au>
                  <snm>Miya</snm>
                  <fnm>M</fnm>
               </au>
               <au>
                  <snm>Tsukamoto</snm>
                  <fnm>K</fnm>
               </au>
               <au>
                  <snm>Nishida</snm>
                  <fnm>M</fnm>
               </au>
            </aug>
            <source>Mol Phylogenet Evol</source>
            <pubdate>2003</pubdate>
            <volume>26</volume>
            <fpage>110</fpage>
            <lpage>120</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1016/S1055-7903(02)00331-7</pubid>
                  <pubid idtype="pmpid" link="fulltext">12470943</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B27">
            <title>
               <p>Major patterns of higher teleostean phylogenies: a new perspective based on 100 complete mitochondrial DNA sequences</p>
            </title>
            <aug>
               <au>
                  <snm>Miya</snm>
                  <fnm>M</fnm>
               </au>
               <au>
                  <snm>Takeshima</snm>
                  <fnm>H</fnm>
               </au>
               <au>
                  <snm>Endo</snm>
                  <fnm>H</fnm>
               </au>
               <au>
                  <snm>Ishiguro</snm>
                  <fnm>NB</fnm>
               </au>
               <au>
                  <snm>Inoue</snm>
                  <fnm>JG</fnm>
               </au>
               <au>
                  <snm>Mukai</snm>
                  <fnm>T</fnm>
               </au>
               <au>
                  <snm>Satoh</snm>
                  <fnm>TP</fnm>
               </au>
               <au>
                  <snm>Yamaguchi</snm>
                  <fnm>M</fnm>
               </au>
               <au>
                  <snm>Kawaguchi</snm>
                  <fnm>A</fnm>
               </au>
               <au>
                  <snm>Mabuchi</snm>
                  <fnm>K</fnm>
               </au>
               <au>
                  <snm>Shirai</snm>
                  <fnm>SM</fnm>
               </au>
               <au>
                  <snm>Nishida</snm>
                  <fnm>M</fnm>
               </au>
            </aug>
            <source>Mol Phylogenet Evol</source>
            <pubdate>2003</pubdate>
            <volume>26</volume>
            <fpage>121</fpage>
            <lpage>138</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1016/S1055-7903(02)00332-9</pubid>
                  <pubid idtype="pmpid" link="fulltext">12470944</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B28">
            <title>
               <p>From 2R to 3R: evidence for a fish-specific genome duplication (FSGD)</p>
            </title>
            <aug>
               <au>
                  <snm>Meyer</snm>
                  <fnm>A</fnm>
               </au>
               <au>
                  <snm>Peer</snm>
                  <mnm>Van de</mnm>
                  <fnm>Y</fnm>
               </au>
            </aug>
            <source>Bioessays</source>
            <pubdate>2005</pubdate>
            <volume>27</volume>
            <fpage>937</fpage>
            <lpage>945</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1002/bies.20293</pubid>
                  <pubid idtype="pmpid" link="fulltext">16108068</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B29">
            <title>
               <p>Gene duplication and spectral diversification of cone visual pigments of zebrafish</p>
            </title>
            <aug>
               <au>
                  <snm>Chinen</snm>
                  <fnm>A</fnm>
               </au>
               <au>
                  <snm>Hamaoka</snm>
                  <fnm>T</fnm>
               </au>
               <au>
                  <snm>Yamada</snm>
                  <fnm>Y</fnm>
               </au>
               <au>
                  <snm>Kawamura</snm>
                  <fnm>S</fnm>
               </au>
            </aug>
            <source>Genetics</source>
            <pubdate>2003</pubdate>
            <volume>163</volume>
            <fpage>663</fpage>
            <lpage>675</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">1462461</pubid>
                  <pubid idtype="pmpid" link="fulltext">12618404</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B30">
            <title>
               <p>Functional characterization of visual opsin repertoire in medaka (<it>Oryzias latipes</it>)</p>
            </title>
            <aug>
               <au>
                  <snm>Matsumoto</snm>
                  <fnm>Y</fnm>
               </au>
               <au>
                  <snm>Fukamachi</snm>
                  <fnm>S</fnm>
               </au>
               <au>
                  <snm>Mitani</snm>
                  <fnm>H</fnm>
               </au>
               <au>
                  <snm>Kawamura</snm>
                  <fnm>S</fnm>
               </au>
            </aug>
            <source>Gene</source>
            <pubdate>2006</pubdate>
            <volume>371</volume>
            <fpage>268</fpage>
            <lpage>278</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1016/j.gene.2005.12.005</pubid>
                  <pubid idtype="pmpid" link="fulltext">16460888</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B31">
            <title>
               <p>Evolution of signal transduction by gene and genome duplication in fish</p>
            </title>
            <aug>
               <au>
                  <snm>Volff</snm>
                  <fnm>JN</fnm>
               </au>
               <au>
                  <snm>Schartl</snm>
                  <fnm>M</fnm>
               </au>
            </aug>
            <source>J Struct Funct Genomics</source>
            <pubdate>2003</pubdate>
            <volume>3</volume>
            <fpage>139</fpage>
            <lpage>150</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1023/A:1022678305005</pubid>
                  <pubid idtype="pmpid" link="fulltext">12836693</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B32">
            <title>
               <p>Comprehensive EST analysis of Atlantic halibut (<it>Hippoglossus hippoglossus</it>), a commercially relevant aquaculture species</p>
            </title>
            <aug>
               <au>
                  <snm>Douglas</snm>
                  <fnm>SE</fnm>
               </au>
               <au>
                  <snm>Knickle</snm>
                  <fnm>LC</fnm>
               </au>
               <au>
                  <snm>Kimball</snm>
                  <fnm>J</fnm>
               </au>
               <au>
                  <snm>Reith</snm>
                  <fnm>ME</fnm>
               </au>
            </aug>
            <source>BMC Genomics</source>
            <pubdate>2007</pubdate>
            <volume>8</volume>
            <fpage>144</fpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">1924502</pubid>
                  <pubid idtype="pmpid" link="fulltext">17547761</pubid>
                  <pubid idtype="doi">10.1186/1471-2164-8-144</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B33">
            <title>
               <p>Genes expressed in Blue Fin Tuna (<it>Thunnus thynnus</it>) liver and gonads</p>
            </title>
            <aug>
               <au>
                  <snm>Chini</snm>
                  <fnm>V</fnm>
               </au>
               <au>
                  <snm>Cattaneo</snm>
                  <fnm>AG</fnm>
               </au>
               <au>
                  <snm>Rossi</snm>
                  <fnm>F</fnm>
               </au>
               <au>
                  <snm>Bernardini</snm>
                  <fnm>G</fnm>
               </au>
               <au>
                  <snm>Terova</snm>
                  <fnm>G</fnm>
               </au>
               <au>
                  <snm>Saroglia</snm>
                  <fnm>M</fnm>
               </au>
               <au>
                  <snm>Gornati</snm>
                  <fnm>R</fnm>
               </au>
            </aug>
            <source>Gene</source>
            <pubdate>2008</pubdate>
            <volume>410</volume>
            <fpage>207</fpage>
            <lpage>213</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1016/j.gene.2007.12.012</pubid>
                  <pubid idtype="pmpid" link="fulltext">18234455</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B34">
            <title>
               <p>Induced ovulation and spawning of pond raised African giant catfish, <it>Heterobranchus bidorsalis </it>by exogenous hormones</p>
            </title>
            <aug>
               <au>
                  <snm>Adebayo</snm>
                  <fnm>OT</fnm>
               </au>
               <au>
                  <snm>Fagbenro</snm>
                  <fnm>OA</fnm>
               </au>
            </aug>
            <source>Aquaculture</source>
            <pubdate>2004</pubdate>
            <volume>242</volume>
            <fpage>229</fpage>
            <lpage>236</lpage>
            <xrefbib>
               <pubid idtype="doi">10.1016/j.aquaculture.2004.07.019</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B35">
            <title>
               <p>Stages of oocyte development in the zebrafish, <it>Brachydanio rerio</it></p>
            </title>
            <aug>
               <au>
                  <snm>Selman</snm>
                  <fnm>K</fnm>
               </au>
               <au>
                  <snm>Wallace</snm>
                  <fnm>RA</fnm>
               </au>
               <au>
                  <snm>Sarka</snm>
                  <fnm>A</fnm>
               </au>
               <au>
                  <snm>Qi</snm>
                  <fnm>X</fnm>
               </au>
            </aug>
            <source>J Morphol</source>
            <pubdate>1993</pubdate>
            <volume>218</volume>
            <fpage>203</fpage>
            <lpage>224</lpage>
            <xrefbib>
               <pubid idtype="doi">10.1002/jmor.1052180209</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B36">
            <title>
               <p>Developmental roles of pufferfish Hox clusters and genome evolution in ray-fin fish</p>
            </title>
            <aug>
               <au>
                  <snm>Amores</snm>
                  <fnm>A</fnm>
               </au>
               <au>
                  <snm>Suzuki</snm>
                  <fnm>T</fnm>
               </au>
               <au>
                  <snm>Yan</snm>
                  <fnm>YL</fnm>
               </au>
               <au>
                  <snm>Pomeroy</snm>
                  <fnm>J</fnm>
               </au>
               <au>
                  <snm>Singer</snm>
                  <fnm>A</fnm>
               </au>
               <au>
                  <snm>Amemiya</snm>
                  <fnm>C</fnm>
               </au>
               <au>
                  <snm>Postlethwait</snm>
                  <fnm>JH</fnm>
               </au>
            </aug>
            <source>Genome Res</source>
            <pubdate>2004</pubdate>
            <volume>14</volume>
            <fpage>1</fpage>
            <lpage>10</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">314266</pubid>
                  <pubid idtype="pmpid" link="fulltext">14707165</pubid>
                  <pubid idtype="doi">10.1101/gr.1717804</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B37">
            <title>
               <p>The zebrafish gene map defines ancestral vertebrate chromosomes</p>
            </title>
            <aug>
               <au>
                  <snm>Woods</snm>
                  <fnm>IG</fnm>
               </au>
               <au>
                  <snm>Wilson</snm>
                  <fnm>C</fnm>
               </au>
               <au>
                  <snm>Friedlander</snm>
                  <fnm>B</fnm>
               </au>
               <au>
                  <snm>Chang</snm>
                  <fnm>P</fnm>
               </au>
               <au>
                  <snm>Reyes</snm>
                  <fnm>DK</fnm>
               </au>
               <au>
                  <snm>Nix</snm>
                  <fnm>R</fnm>
               </au>
               <au>
                  <snm>Kelly</snm>
                  <fnm>PD</fnm>
               </au>
               <au>
                  <snm>Chu</snm>
                  <fnm>F</fnm>
               </au>
               <au>
                  <snm>Postlethwait</snm>
                  <fnm>JH</fnm>
               </au>
               <au>
                  <snm>Talbot</snm>
                  <fnm>WS</fnm>
               </au>
            </aug>
            <source>Genome Res</source>
            <pubdate>2005</pubdate>
            <volume>15</volume>
            <fpage>1307</fpage>
            <lpage>1314</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">1199546</pubid>
                  <pubid idtype="pmpid" link="fulltext">16109975</pubid>
                  <pubid idtype="doi">10.1101/gr.4134305</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B38">
            <title>
               <p>Effect of cortisol on aquaporin expression in the esophagus of the European eel, <it>Anguilla anguilla</it></p>
            </title>
            <aug>
               <au>
                  <snm>Martinez</snm>
                  <fnm>AS</fnm>
               </au>
               <au>
                  <snm>Wilson</snm>
                  <fnm>G</fnm>
               </au>
               <au>
                  <snm>Phillips</snm>
                  <fnm>C</fnm>
               </au>
               <au>
                  <snm>Cutler</snm>
                  <fnm>C</fnm>
               </au>
               <au>
                  <snm>Hazon</snm>
                  <fnm>N</fnm>
               </au>
               <au>
                  <snm>Cramb</snm>
                  <fnm>G</fnm>
               </au>
            </aug>
            <source>Ann NY Acad Sci</source>
            <pubdate>2005</pubdate>
            <volume>1040</volume>
            <fpage>395</fpage>
            <lpage>398</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1196/annals.1327.072</pubid>
                  <pubid idtype="pmpid" link="fulltext">15891071</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B39">
            <title>
               <p>Intestinal anion exchange in marine fish osmoregulation</p>
            </title>
            <aug>
               <au>
                  <snm>Grosell</snm>
                  <fnm>M</fnm>
               </au>
            </aug>
            <source>J Exp Biol</source>
            <pubdate>2006</pubdate>
            <volume>209</volume>
            <fpage>2813</fpage>
            <lpage>2827</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1242/jeb.02345</pubid>
                  <pubid idtype="pmpid" link="fulltext">16857865</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B40">
            <title>
               <p>Heteroligomerization of an aquaporin-2 mutant with wild-type Aquaporin-2 and their misrouting to late endosomes/lysosomes explains dominant nephrogenic diabetes insipidus</p>
            </title>
            <aug>
               <au>
                  <snm>Marr</snm>
                  <fnm>N</fnm>
               </au>
               <au>
                  <snm>Bichet</snm>
                  <fnm>DG</fnm>
               </au>
               <au>
                  <snm>Lonergan</snm>
                  <fnm>M</fnm>
               </au>
               <au>
                  <snm>Arthus</snm>
                  <fnm>MF</fnm>
               </au>
               <au>
                  <snm>Jeck</snm>
                  <fnm>N</fnm>
               </au>
               <au>
                  <snm>Seyberth</snm>
                  <fnm>HW</fnm>
               </au>
               <au>
                  <snm>Rosenthal</snm>
                  <fnm>W</fnm>
               </au>
               <au>
                  <snm>van Os</snm>
                  <fnm>CH</fnm>
               </au>
               <au>
                  <snm>Oksche</snm>
                  <fnm>A</fnm>
               </au>
               <au>
                  <snm>Deen</snm>
                  <fnm>PM</fnm>
               </au>
            </aug>
            <source>Hum Mol Genet</source>
            <pubdate>2002</pubdate>
            <volume>11</volume>
            <fpage>779</fpage>
            <lpage>789</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1093/hmg/11.7.779</pubid>
                  <pubid idtype="pmpid" link="fulltext">11929850</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B41">
            <title>
               <p>A novel C-terminal motif is necessary for the export of the vasopressin V1b/V3 receptor to the plasma membrane</p>
            </title>
            <aug>
               <au>
                  <snm>Robert</snm>
                  <fnm>J</fnm>
               </au>
               <au>
                  <snm>Clauser</snm>
                  <fnm>E</fnm>
               </au>
               <au>
                  <snm>Petit</snm>
                  <fnm>PX</fnm>
               </au>
               <au>
                  <snm>Ventura</snm>
                  <fnm>MA</fnm>
               </au>
            </aug>
            <source>J Biol Chem</source>
            <pubdate>2005</pubdate>
            <volume>280</volume>
            <fpage>2300</fpage>
            <lpage>2308</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1074/jbc.M410655200</pubid>
                  <pubid idtype="pmpid" link="fulltext">15528211</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B42">
            <title>
               <p>Structural requirements and sequence motifs for polarized sorting and endocytosis of LDL and Fc receptors in MDCK cells</p>
            </title>
            <aug>
               <au>
                  <snm>Matter</snm>
                  <fnm>K</fnm>
               </au>
               <au>
                  <snm>Yamamoto</snm>
                  <fnm>EM</fnm>
               </au>
               <au>
                  <snm>Mellman</snm>
                  <fnm>I</fnm>
               </au>
            </aug>
            <source>J Cell Biol</source>
            <pubdate>1994</pubdate>
            <volume>126</volume>
            <fpage>991</fpage>
            <lpage>1004</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">2120116</pubid>
                  <pubid idtype="pmpid" link="fulltext">8051216</pubid>
                  <pubid idtype="doi">10.1083/jcb.126.4.991</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B43">
            <title>
               <p>A dileucine motif targets E-cadherin to the basolateral cell surface in Madin-Darby canine kidney and LLC-PK1 epithelial cells</p>
            </title>
            <aug>
               <au>
                  <snm>Miranda</snm>
                  <fnm>KC</fnm>
               </au>
               <au>
                  <snm>Khromykh</snm>
                  <fnm>T</fnm>
               </au>
               <au>
                  <snm>Christy</snm>
                  <fnm>P</fnm>
               </au>
               <au>
                  <snm>Le</snm>
                  <fnm>TL</fnm>
               </au>
               <au>
                  <snm>Gottardi</snm>
                  <fnm>CJ</fnm>
               </au>
               <au>
                  <snm>Yap</snm>
                  <fnm>AS</fnm>
               </au>
               <au>
                  <snm>Stow</snm>
                  <fnm>JL</fnm>
               </au>
               <au>
                  <snm>Teasdale</snm>
                  <fnm>RD</fnm>
               </au>
            </aug>
            <source>J Biol Chem</source>
            <pubdate>2001</pubdate>
            <volume>276</volume>
            <fpage>22565</fpage>
            <lpage>22572</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1074/jbc.M101907200</pubid>
                  <pubid idtype="pmpid" link="fulltext">11312273</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B44">
            <title>
               <p>Multiple endocytic signals in the C-terminal tail of the cystic fibrosis transmembrane conductance regulator</p>
            </title>
            <aug>
               <au>
                  <snm>Hu</snm>
                  <fnm>W</fnm>
               </au>
               <au>
                  <snm>Howard</snm>
                  <fnm>M</fnm>
               </au>
               <au>
                  <snm>Lukacs</snm>
                  <fnm>GL</fnm>
               </au>
            </aug>
            <source>Biochem J</source>
            <pubdate>2001</pubdate>
            <volume>354</volume>
            <fpage>561</fpage>
            <lpage>572</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">1221687</pubid>
                  <pubid idtype="pmpid" link="fulltext">11237860</pubid>
                  <pubid idtype="doi">10.1042/0264-6021:3540561</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B45">
            <title>
               <p>Role of two dileucine-like motifs in insulin receptor anchoring to microvilli</p>
            </title>
            <aug>
               <au>
                  <snm>Shackleton</snm>
                  <fnm>S</fnm>
               </au>
               <au>
                  <snm>Hamer</snm>
                  <fnm>I</fnm>
               </au>
               <au>
                  <snm>Foti</snm>
                  <fnm>M</fnm>
               </au>
               <au>
                  <snm>Zumwald</snm>
                  <fnm>N</fnm>
               </au>
               <au>
                  <snm>Maeder</snm>
                  <fnm>C</fnm>
               </au>
               <au>
                  <snm>Carpentier</snm>
                  <fnm>JL</fnm>
               </au>
            </aug>
            <source>J Biol Chem</source>
            <pubdate>2002</pubdate>
            <volume>277</volume>
            <fpage>43631</fpage>
            <lpage>43637</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1074/jbc.M204036200</pubid>
                  <pubid idtype="pmpid" link="fulltext">12218050</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B46">
            <title>
               <p>Polarized trafficking and surface expression of the AQP4 water channel are coordinated by serial and regulated interactions with different clathrin-adaptor complexes</p>
            </title>
            <aug>
               <au>
                  <snm>Madrid</snm>
                  <fnm>R</fnm>
               </au>
               <au>
                  <snm>Le Maout</snm>
                  <fnm>S</fnm>
               </au>
               <au>
                  <snm>Barrault</snm>
                  <fnm>MB</fnm>
               </au>
               <au>
                  <snm>Janvier</snm>
                  <fnm>K</fnm>
               </au>
               <au>
                  <snm>Benichou</snm>
                  <fnm>S</fnm>
               </au>
               <au>
                  <snm>Merot</snm>
                  <fnm>J</fnm>
               </au>
            </aug>
            <source>EMBO J</source>
            <pubdate>2001</pubdate>
            <volume>20</volume>
            <fpage>7008</fpage>
            <lpage>7021</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">125333</pubid>
                  <pubid idtype="pmpid" link="fulltext">11742978</pubid>
                  <pubid idtype="doi">10.1093/emboj/20.24.7008</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B47">
            <title>
               <p>The role of putative phosphorylation sites in the targeting and shuttling of the aquaporin-2 water channel</p>
            </title>
            <aug>
               <au>
                  <snm>van Balkom</snm>
                  <fnm>BW</fnm>
               </au>
               <au>
                  <snm>Savelkoul</snm>
                  <fnm>PJ</fnm>
               </au>
               <au>
                  <snm>Markovich</snm>
                  <fnm>D</fnm>
               </au>
               <au>
                  <snm>Hofman</snm>
                  <fnm>E</fnm>
               </au>
               <au>
                  <snm>Nielsen</snm>
                  <fnm>S</fnm>
               </au>
               <au>
                  <snm>Sluijs</snm>
                  <mnm>van der</mnm>
                  <fnm>P</fnm>
               </au>
               <au>
                  <snm>Deen</snm>
                  <fnm>PM</fnm>
               </au>
            </aug>
            <source>J Biol Chem</source>
            <pubdate>2002</pubdate>
            <volume>277</volume>
            <fpage>41473</fpage>
            <lpage>41479</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1074/jbc.M207525200</pubid>
                  <pubid idtype="pmpid" link="fulltext">12194985</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B48">
            <title>
               <p>Regulation of the meiosis-inhibited protein kinase, a p38(MAPK) isoform, during meiosis and following fertilization of seastar oocytes</p>
            </title>
            <aug>
               <au>
                  <snm>Morrison</snm>
                  <fnm>DL</fnm>
               </au>
               <au>
                  <snm>Yee</snm>
                  <fnm>A</fnm>
               </au>
               <au>
                  <snm>Paddon</snm>
                  <fnm>HB</fnm>
               </au>
               <au>
                  <snm>Vilimek</snm>
                  <fnm>D</fnm>
               </au>
               <au>
                  <snm>Aebersold</snm>
                  <fnm>R</fnm>
               </au>
               <au>
                  <snm>Pelech</snm>
                  <fnm>SL</fnm>
               </au>
            </aug>
            <source>J Biol Chem</source>
            <pubdate>2000</pubdate>
            <volume>275</volume>
            <fpage>34236</fpage>
            <lpage>34244</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1074/jbc.M004656200</pubid>
                  <pubid idtype="pmpid" link="fulltext">10906138</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B49">
            <title>
               <p>Xp38gamma/SAPK3 promotes meiotic G(2)/M transition in <it>Xenopus </it>oocytes and activates Cdc25C</p>
            </title>
            <aug>
               <au>
                  <snm>Perdiguero</snm>
                  <fnm>E</fnm>
               </au>
               <au>
                  <snm>Pillaire</snm>
                  <fnm>MJ</fnm>
               </au>
               <au>
                  <snm>Bodart</snm>
                  <fnm>JF</fnm>
               </au>
               <au>
                  <snm>Hennersdorf</snm>
                  <fnm>F</fnm>
               </au>
               <au>
                  <snm>Fr&#246;din</snm>
                  <fnm>M</fnm>
               </au>
               <au>
                  <snm>Duesbery</snm>
                  <fnm>NS</fnm>
               </au>
               <au>
                  <snm>Alonso</snm>
                  <fnm>G</fnm>
               </au>
               <au>
                  <snm>Nebreda</snm>
                  <fnm>AR</fnm>
               </au>
            </aug>
            <source>EMBO J</source>
            <pubdate>2003</pubdate>
            <volume>22</volume>
            <fpage>5746</fpage>
            <lpage>5756</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">275416</pubid>
                  <pubid idtype="pmpid" link="fulltext">14592973</pubid>
                  <pubid idtype="doi">10.1093/emboj/cdg559</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B50">
            <title>
               <p>Activation of p38 MAPK during porcine oocyte maturation</p>
            </title>
            <aug>
               <au>
                  <snm>Villa-Diaz</snm>
                  <fnm>LG</fnm>
               </au>
               <au>
                  <snm>Miyano</snm>
                  <fnm>T</fnm>
               </au>
            </aug>
            <source>Biol Reprod</source>
            <pubdate>2004</pubdate>
            <volume>71</volume>
            <fpage>691</fpage>
            <lpage>696</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1095/biolreprod.103.026310</pubid>
                  <pubid idtype="pmpid" link="fulltext">15115730</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B51">
            <title>
               <p>The zebrafish book</p>
            </title>
            <aug>
               <au>
                  <snm>Westerfield</snm>
                  <fnm>M</fnm>
               </au>
            </aug>
            <publisher>Seattle, Oregon, University of Oregon Press</publisher>
            <edition>2</edition>
            <pubdate>1995</pubdate>
         </bibl>
         <bibl id="B52">
            <title>
               <p>Induction of spawning of captive-reared Senegal sole (<it>Solea senegalensis</it>) using different delivery systems for gonadotropin-releasing hormone agonist</p>
            </title>
            <aug>
               <au>
                  <snm>Agulleiro</snm>
                  <fnm>MJ</fnm>
               </au>
               <au>
                  <snm>Anguis</snm>
                  <fnm>V</fnm>
               </au>
               <au>
                  <snm>Ca&#241;avate</snm>
                  <fnm>JP</fnm>
               </au>
               <au>
                  <snm>Mart&#237;nez-Rodr&#237;guez</snm>
                  <fnm>G</fnm>
               </au>
               <au>
                  <snm>Mylonas</snm>
                  <fnm>CC</fnm>
               </au>
               <au>
                  <snm>Cerd&#224;</snm>
                  <fnm>J</fnm>
               </au>
            </aug>
            <source>Aquaculture</source>
            <pubdate>2006</pubdate>
            <volume>257</volume>
            <fpage>511</fpage>
            <lpage>524</lpage>
            <xrefbib>
               <pubid idtype="doi">10.1016/j.aquaculture.2006.02.001</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B53">
            <title>
               <p>Sexually mature European eels (<it>Anguilla anguilla </it>L.) stimulate gonadal development of neighbouring males: possible involvement of chemical communication</p>
            </title>
            <aug>
               <au>
                  <snm>Huertas</snm>
                  <fnm>M</fnm>
               </au>
               <au>
                  <snm>Scott</snm>
                  <fnm>AP</fnm>
               </au>
               <au>
                  <snm>Hubbard</snm>
                  <fnm>PC</fnm>
               </au>
               <au>
                  <snm>Can&#225;rio</snm>
                  <fnm>AVM</fnm>
               </au>
               <au>
                  <snm>Cerd&#224;</snm>
                  <fnm>J</fnm>
               </au>
            </aug>
            <source>Gen Comp Endocrinol</source>
            <pubdate>2006</pubdate>
            <volume>147</volume>
            <fpage>304</fpage>
            <lpage>313</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1016/j.ygcen.2006.01.017</pubid>
                  <pubid idtype="pmpid" link="fulltext">16545383</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B54">
            <title>
               <p>Ensembl Project</p>
            </title>
            <url>http://www.ensembl.org</url>
         </bibl>
         <bibl id="B55">
            <title>
               <p>National Center for Biotechnology Information (NCBI)</p>
            </title>
            <url>http://www.ncbi.nlm.nih.gov</url>
         </bibl>
         <bibl id="B56">
            <title>
               <p>CLUSTAL W: improving the sensitivity of progressivemultiple sequence alignment through sequence weighting, position-specific gap penalties and weight matrix choice</p>
            </title>
            <aug>
               <au>
                  <snm>Higgins</snm>
                  <fnm>D</fnm>
               </au>
               <au>
                  <snm>Thompson</snm>
                  <fnm>J</fnm>
               </au>
               <au>
                  <snm>Gibson</snm>
                  <fnm>T</fnm>
               </au>
               <au>
                  <snm>Thompson</snm>
                  <fnm>JD</fnm>
               </au>
               <au>
                  <snm>Higgins</snm>
                  <fnm>DG</fnm>
               </au>
               <au>
                  <snm>Gibson</snm>
                  <fnm>TJ</fnm>
               </au>
            </aug>
            <source>Nucleic Acids Res</source>
            <pubdate>1994</pubdate>
            <volume>22</volume>
            <fpage>4673</fpage>
            <lpage>4680</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">308517</pubid>
                  <pubid idtype="pmpid" link="fulltext">7984417</pubid>
                  <pubid idtype="doi">10.1093/nar/22.22.4673</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B57">
            <title>
               <p>BioEdit: a user-friendly biological sequence alignment editor and analysis program for Windows 95/98/N</p>
            </title>
            <aug>
               <au>
                  <snm>Hall</snm>
                  <fnm>TA</fnm>
               </au>
            </aug>
            <source>Nucleic Acids Symp</source>
            <pubdate>1999</pubdate>
            <volume>41</volume>
            <fpage>95</fpage>
            <lpage>98</lpage>
         </bibl>
         <bibl id="B58">
            <title>
               <p>The neighbor-joining method: a new method for reconstructing phylogenetic trees</p>
            </title>
            <aug>
               <au>
                  <snm>Saitou</snm>
                  <fnm>N</fnm>
               </au>
               <au>
                  <snm>Nei</snm>
                  <fnm>M</fnm>
               </au>
            </aug>
            <source>Mol Biol Evol</source>
            <pubdate>1987</pubdate>
            <volume>4</volume>
            <fpage>406</fpage>
            <lpage>425</lpage>
            <xrefbib>
               <pubid idtype="pmpid" link="fulltext">3447015</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B59">
            <title>
               <p>MEGA3: Integrated software for Molecular Evolutionary Genetics Analysis and sequence alignment</p>
            </title>
            <aug>
               <au>
                  <snm>Kumar</snm>
                  <fnm>S</fnm>
               </au>
               <au>
                  <snm>Tamura</snm>
                  <fnm>K</fnm>
               </au>
               <au>
                  <snm>Nei</snm>
                  <fnm>M</fnm>
               </au>
            </aug>
            <source>Brief Bioinform</source>
            <pubdate>2004</pubdate>
            <volume>5</volume>
            <fpage>150</fpage>
            <lpage>163</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1093/bib/5.2.150</pubid>
                  <pubid idtype="pmpid" link="fulltext">15260895</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B60">
            <title>
               <p>ProtTest: Selection of best-fit models of protein evolution</p>
            </title>
            <aug>
               <au>
                  <snm>Abascal</snm>
                  <fnm>F</fnm>
               </au>
               <au>
                  <snm>Zardoya</snm>
                  <fnm>R</fnm>
               </au>
               <au>
                  <snm>Posada</snm>
                  <fnm>D</fnm>
               </au>
            </aug>
            <source>Bioinformatics</source>
            <pubdate>2005</pubdate>
            <volume>21</volume>
            <fpage>2104</fpage>
            <lpage>2105</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1093/bioinformatics/bti263</pubid>
                  <pubid idtype="pmpid" link="fulltext">15647292</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B61">
            <title>
               <p>A simple, fast, and accurate algorithm to estimate large phylogenies by maximum likelihood</p>
            </title>
            <aug>
               <au>
                  <snm>Guindon</snm>
                  <fnm>S</fnm>
               </au>
               <au>
                  <snm>Gascuel</snm>
                  <fnm>O</fnm>
               </au>
            </aug>
            <source>Syst Biol</source>
            <pubdate>2003</pubdate>
            <volume>52</volume>
            <fpage>696</fpage>
            <lpage>704</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1080/10635150390235520</pubid>
                  <pubid idtype="pmpid">14530136</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B62">
            <title>
               <p>MrBayes 3: Bayesian phylogenetic inference under mixed models</p>
            </title>
            <aug>
               <au>
                  <snm>Ronquist</snm>
                  <fnm>F</fnm>
               </au>
               <au>
                  <snm>Huelsenbeck</snm>
                  <fnm>JP</fnm>
               </au>
            </aug>
            <source>Bioinformatics</source>
            <pubdate>2003</pubdate>
            <volume>19</volume>
            <fpage>1572</fpage>
            <lpage>1574</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1093/bioinformatics/btg180</pubid>
                  <pubid idtype="pmpid" link="fulltext">12912839</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B63">
            <title>
               <p>Sequence- and structure-based prediction of eukaryotic protein phosphorylation sites</p>
            </title>
            <aug>
               <au>
                  <snm>Blom</snm>
                  <fnm>N</fnm>
               </au>
               <au>
                  <snm>Gammeltoft</snm>
                  <fnm>S</fnm>
               </au>
               <au>
                  <snm>Brunak</snm>
                  <fnm>S</fnm>
               </au>
            </aug>
            <source>J Mol Biol</source>
            <pubdate>1999</pubdate>
            <volume>294</volume>
            <fpage>1351</fpage>
            <lpage>1362</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1006/jmbi.1999.3310</pubid>
                  <pubid idtype="pmpid" link="fulltext">10600390</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B64">
            <title>
               <p>ELM server: a new resource for investigating short functional sites in modular eukaryotic proteins</p>
            </title>
            <aug>
               <au>
                  <snm>Puntervoll</snm>
                  <fnm>P</fnm>
               </au>
               <au>
                  <snm>Linding</snm>
                  <fnm>R</fnm>
               </au>
               <au>
                  <snm>Gem&#252;nd</snm>
                  <fnm>C</fnm>
               </au>
               <au>
                  <snm>Chabanis-Davidson</snm>
                  <fnm>S</fnm>
               </au>
               <au>
                  <snm>Mattingsdal</snm>
                  <fnm>M</fnm>
               </au>
               <au>
                  <snm>Cameron</snm>
                  <fnm>S</fnm>
               </au>
               <au>
                  <snm>Martin</snm>
                  <fnm>DMA</fnm>
               </au>
               <au>
                  <snm>Ausiello</snm>
                  <fnm>G</fnm>
               </au>
               <au>
                  <snm>Brannetti</snm>
                  <fnm>B</fnm>
               </au>
               <au>
                  <snm>Costantini</snm>
                  <fnm>A</fnm>
               </au>
               <au>
                  <snm>Ferr&#232;</snm>
                  <fnm>F</fnm>
               </au>
               <au>
                  <snm>Maselli</snm>
                  <fnm>V</fnm>
               </au>
               <au>
                  <snm>Via</snm>
                  <fnm>A</fnm>
               </au>
               <au>
                  <snm>Cesareni</snm>
                  <fnm>G</fnm>
               </au>
               <au>
                  <snm>Diella</snm>
                  <fnm>F</fnm>
               </au>
               <au>
                  <snm>Superti-Furga</snm>
                  <fnm>G</fnm>
               </au>
               <au>
                  <snm>Wyrwicz</snm>
                  <fnm>L</fnm>
               </au>
               <au>
                  <snm>Ramu</snm>
                  <fnm>C</fnm>
               </au>
               <au>
                  <snm>McGuigan</snm>
                  <fnm>C</fnm>
               </au>
               <au>
                  <snm>Gudavalli</snm>
                  <fnm>R</fnm>
               </au>
               <au>
                  <snm>Letunic</snm>
                  <fnm>I</fnm>
               </au>
               <au>
                  <snm>Bork</snm>
                  <fnm>P</fnm>
               </au>
               <au>
                  <snm>Rychlewski</snm>
                  <fnm>L</fnm>
               </au>
               <au>
                  <snm>K&#252;ster</snm>
                  <fnm>B</fnm>
               </au>
               <au>
                  <snm>Helmer-Citterich</snm>
                  <fnm>M</fnm>
               </au>
               <au>
                  <snm>Hunter</snm>
                  <fnm>WN</fnm>
               </au>
               <au>
                  <snm>Aasland</snm>
                  <fnm>R</fnm>
               </au>
               <au>
                  <snm>Gibson</snm>
                  <fnm>TJ</fnm>
               </au>
            </aug>
            <source>Nucleic Acids Res</source>
            <pubdate>2003</pubdate>
            <volume>31</volume>
            <fpage>3625</fpage>
            <lpage>3630</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">168952</pubid>
                  <pubid idtype="pmpid" link="fulltext">12824381</pubid>
                  <pubid idtype="doi">10.1093/nar/gkg545</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B65">
            <title>
               <p>Requirement of human renal water channel aquaporin-2 for vasopressin-dependent concentration of urine</p>
            </title>
            <aug>
               <au>
                  <snm>Deen</snm>
                  <fnm>PM</fnm>
               </au>
               <au>
                  <snm>Verdijk</snm>
                  <fnm>MA</fnm>
               </au>
               <au>
                  <snm>Knoers</snm>
                  <fnm>NV</fnm>
               </au>
               <au>
                  <snm>Wieringa</snm>
                  <fnm>B</fnm>
               </au>
               <au>
                  <snm>Monnens</snm>
                  <fnm>LA</fnm>
               </au>
               <au>
                  <snm>van Os</snm>
                  <fnm>CH</fnm>
               </au>
               <au>
                  <snm>van Oost</snm>
                  <fnm>BA</fnm>
               </au>
            </aug>
            <source>Science</source>
            <pubdate>1994</pubdate>
            <volume>264</volume>
            <fpage>92</fpage>
            <lpage>95</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1126/science.8140421</pubid>
                  <pubid idtype="pmpid" link="fulltext">8140421</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B66">
            <title>
               <p>Detection of aquaporin-2 in the plasma membranes of oocytes: a novel isolation method with improved yield and purity</p>
            </title>
            <aug>
               <au>
                  <snm>Kamsteeg</snm>
                  <fnm>EJ</fnm>
               </au>
               <au>
                  <snm>Deen</snm>
                  <fnm>PM</fnm>
               </au>
            </aug>
            <source>Biochem Biophys Res Commun</source>
            <pubdate>2001</pubdate>
            <volume>282</volume>
            <fpage>683</fpage>
            <lpage>690</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1006/bbrc.2001.4629</pubid>
                  <pubid idtype="pmpid" link="fulltext">11401515</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B67">
            <title>
               <p>The human aquaporin-CHIP gene. Structure, organization, and chromosomal localization</p>
            </title>
            <aug>
               <au>
                  <snm>Moon</snm>
                  <fnm>C</fnm>
               </au>
               <au>
                  <snm>Preston</snm>
                  <fnm>GM</fnm>
               </au>
               <au>
                  <snm>Griffin</snm>
                  <fnm>CA</fnm>
               </au>
               <au>
                  <snm>Jabs</snm>
                  <fnm>EW</fnm>
               </au>
               <au>
                  <snm>Agre</snm>
                  <fnm>P</fnm>
               </au>
            </aug>
            <source>J Biol Chem</source>
            <pubdate>1993</pubdate>
            <volume>268</volume>
            <fpage>15772</fpage>
            <lpage>15778</lpage>
            <xrefbib>
               <pubid idtype="pmpid" link="fulltext">8340403</pubid>
            </xrefbib>
         </bibl>
      </refgrp>
   </bm>
</art>

