Table 1

Recently identified teretoxins.

Teretoxin

Mature Toxin Sequence

Corresponding conotoxin Superfamily

Potential Target


Agx-s11a

DCEQHTDCSAASGPVYCCQDSDCCGGVDYICTNYGQCVRHF

I

K+ channels


Agx-s6a

SLDEELKSNDCPEYCPHGNECCEHHECRYDPWSRELKCLDSLDS

O

Na+, K+, Ca2+ Channels


Agx-s7a

ATNRHQCDTNDDCEEDECCVLVGGNVNNPGVQTRICLACS

O

Na+, K+, Ca2+ Channels


Hhe6.3

VLFTPPELLGCGNRCSDDCCKWGRCQPGCTD

O

Na+, K+, Ca2+ Channels


Hhe9.1

YEENCGTEYCTSKIGCPGRCVCKEYNYNGEITRRCRA

P

Unknown


Hhe9.2

DEEVGCFPNVCKNDGNCSIETSTGMTRCQCLEGYTGHVCENPL

P

Unknown


Puillandre and Holford BMC Chemical Biology 2010 10:7   doi:10.1186/1472-6769-10-7

Open Data