Table 3

SOX11-specific peptide used for immunization
Antigen Alias Sequence1
SOX11 p-SOX11c-term EDDDDDDDDDELQLQIKQEPDEEDEEPPHQQLLQPPGQQPSQLLRRYNVAKVPASPTLSSSAESPEGASLYDEVRAGATSGAGGGSRLYYSFKNITKQHPPPLAQPALSPASSRSVSTSSS

1Sequence was originally derived from the HPR project as previously described [35].

Nordström et al.

Nordström et al. BMC Cancer 2012 12:269   doi:10.1186/1471-2407-12-269

Open Data