BMC Plant Biology

official impact factor 4.09

Open Access Highly Access Research article

Characterization of WRKY co-regulatory networks in rice and Arabidopsis

Stefano Berri1,2, Pamela Abbruscato3, Odile Faivre-Rampant3,4, Ana CM Brasileiro5,6, Irene Fumasoni3, Kouji Satoh7, Shoshi Kikuchi7, Luca Mizzi1, Piero Morandini8, Mario E Pè1,9 and Pietro Piffanelli3*

Author Affiliations

1 Department of Biomolecular Sciences and Biotechnology, University of Milan, via Celoria 26, 20133 Milan, Italy

2 School of Computing, University of Leeds, LS2 9JT Leeds, UK

3 Rice Genomics Unit, Parco Tecnologico Padano, via Einstein, 26900 Lodi, Italy

4 UMR BGPI, CIRAD, Campus International de Baillarguet, 34398 Montpellier Cedex 5, France

5 Parque Estação Biológica, Embrapa Recursos Genéticos e Biotecnologia, Av. W5 Norte, 02372, Brasília DF, Brazil

6 UMR DAP, CIRAD, Avenue Agropolis, 34398 Montpellier Cedex 5, France

7 Department of Molecular Genetics, National Institute of Agrobiological Sciences, 2-1-2 Kannon-dai, Tsukuba, Ibaraki 305-8602, Japan

8 Department of Biology, University of Milan and CNR Institut of Biophysics (Milan Section), via Celoria 26, 20133 Milan, Italy

9 Sant'Anna School for Advanced Studies, Piazza Martiri della Libertà 33, 56127 Pisa, Italy

For all author emails, please log on.

BMC Plant Biology 2009, 9:120 doi:10.1186/1471-2229-9-120


The electronic version of this article is the complete one and can be found online at: http://www.biomedcentral.com/1471-2229/9/120


Received:17 December 2008
Accepted:22 September 2009
Published:22 September 2009

© 2009 Berri et al; licensee BioMed Central Ltd.

This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.

Abstract

Background

The WRKY transcription factor gene family has a very ancient origin and has undergone extensive duplications in the plant kingdom. Several studies have pointed out their involvement in a range of biological processes, revealing that a large number of WRKY genes are transcriptionally regulated under conditions of biotic and/or abiotic stress. To investigate the existence of WRKY co-regulatory networks in plants, a whole gene family WRKYs expression study was carried out in rice (Oryza sativa). This analysis was extended to Arabidopsis thaliana taking advantage of an extensive repository of gene expression data.

Results

The presented results suggested that 24 members of the rice WRKY gene family (22% of the total) were differentially-regulated in response to at least one of the stress conditions tested. We defined the existence of nine OsWRKY gene clusters comprising both phylogenetically related and unrelated genes that were significantly co-expressed, suggesting that specific sets of WRKY genes might act in co-regulatory networks. This hypothesis was tested by Pearson Correlation Coefficient analysis of the Arabidopsis WRKY gene family in a large set of Affymetrix microarray experiments. AtWRKYs were found to belong to two main co-regulatory networks (COR-A, COR-B) and two smaller ones (COR-C and COR-D), all including genes belonging to distinct phylogenetic groups. The COR-A network contained several AtWRKY genes known to be involved mostly in response to pathogens, whose physical and/or genetic interaction was experimentally proven. We also showed that specific co-regulatory networks were conserved between the two model species by identifying Arabidopsis orthologs of the co-expressed OsWRKY genes.

Conclusion

In this work we identified sets of co-expressed WRKY genes in both rice and Arabidopsis that are functionally likely to cooperate in the same signal transduction pathways. We propose that, making use of data from co-regulatory networks, it is possible to highlight novel clusters of plant genes contributing to the same biological processes or signal transduction pathways. Our approach will contribute to unveil gene cooperation pathways not yet identified by classical genetic analyses. This information will open new routes contributing to the dissection of WRKY signal transduction pathways in plants.

Background

WRKY genes code for transcription factors characterized by the presence of one or two 60 amino-acid WRKY motif including a very highly-conserved WRKYGQK sequence together with a zinc-finger-like motif CX4-7 -CX23-28 -HX1-2 -(H/C) that provides binding properties to DNA. Most of the WRKY proteins bind to the conserved W-box (C/T)TGAC(T/C) [1-4]. The WRKY genes were initially believed to be plant-specfic [5], but their ancient origin, is witnessed by the presence of two-domain WRKY in two non-photosynthetic unicellular Eukaryota organisms: in the Diplomonadida Giardia lamblia and in the Mycetozoa Dictyostelium discoideum. An ancestor WRKY gene may, therefore, have already been present before divergence of animals, fungi and plants, but was probably lost in the former groups [6]. The WRKY genes have experienced an incredible evolutionary success in the plant kingdom where successive duplication events have resulted in large gene families that includes up to 74 members in Arabidopsis and over one hundred in rice. The first record of a WRKY gene [7] came from cloning genes from sweet potato (Ipomoea batatas) followed by the description of two WRKY genes (ABF1 and ABF2) in wheat, barley and wild oat [8]. Eulgem et al. [9] described most of the Arabidopsis WRKY genes and classified them on the basis of both the number of WRKY domains and the features of their zinc-finger-like motif. WRKY proteins with two WRKY domains belong to group 1, whereas most proteins with one WRKY domain belong to group 2. In general, the WRKY domains of group 1 and group 2 members have the same type of zinc finger motif, whose pattern of potential zinc ligands CX4-5 -CX22-23 -HXH is unique among all known zinc-finger-like motifs. The single zinc finger motif of a small subset of WRKY proteins is distinct from that of group 1 and 2 members. Instead of a C2H2 pattern, their WRKY domains contain a C2HC motif. As a result of this distinction, they were assigned to group 3 [9].

Several studies have shown that WRKY genes are involved in many different biological processes such as response to wounding [10], senescence [4,11], development [12] dormancy and drought tolerance [13], solar ultraviolet-B radiation [14], metabolism [15,16], hormone signalling pathways [17,18] and cold [19]. However, numerous WRKY genes are involved in response to biotic stress and pathogen attacks. The first evidence for this was shown by Rushton et al. [20] who found three WRKY genes that specifically were able to bind to three W-box in the promoter of the pathogenesis-related gene PR1 in parsley. Later studies showed the involvement of other WRKY genes in response to pathogen, either because they are regulated during infection [3,21-24] or due to their proximity to well characterized genes that play a crucial role in plant defence, such as NPR1 in Arabidopsis [2,25].

Although there are several publications describing WRKY genes, only a few of the respective mutants show a clear link between a WRKY gene and an altered phenotype. In Arabidopsis, the gene TRANSPARENT TESTA GLABRA2 (TTG2) encodes a WRKY transcription factor (AtWRKY44) that, when mutated, causes disruptions to trichome development, different seed coat colour and mucilage production [12]. A second WRKY transcription factor of Arabidopsis is involved in seed development (AtWRKY10, encoded by MINISEED3 [26]); the corresponding mutants show smaller seeds and early cellularization of the endosperm. Despite the availability of insertion mutants for nearly every gene in Arabidopsis [27], a reverse genetic approach has so far only succeeded in revealing pathogen-related phenotypes for a few WRKY genes; the observed phenotypes were often weak or described as "enhanced susceptibility" [28,29]. Typically, phenotypes become detectable by combining mutants in multiple WRKY genes or by over-expression analyses [25]. There are a few exceptions: the atypical gene AtWRKY52 that provides resistance to Ralstonia solanacearum [30], AtWRKY70 whose mutant shows enhanced susceptibility to Erysiphe cichoracearum and differential accumulation of anthocyanins following methyl jasmonate application [31,32]. Similarly, mutation of AtWRKY33 results in enhanced susceptibility to two necrotrophic pathogens, namely Botrytis cinerea and Alternaria brassicola [33]. For 20 WRKY insertion mutants in rice screened in our laboratory (data unpublished) no phenotypic variation was observed for host and non-host pathogen interaction.

The most frequent hypothesis to explain the lack of phenotype in knockout plants is functional redundancy [25,28]. Indeed, lines in which multiple WRKY genes were knocked out, are often produced to test whether a small group of phylogenetically-related genes are redundantly involved in a certain function. It is, therefore, important to clearly understand the phylogenetic relationships between genes of the same family. This has been extensively performed for WRKY genes both in rice and Arabidopsis [9,34,35]. This strategy has been successful in some cases [22,28], but it is still insufficient to pinpoint genes that might be part of the same regulatory network. Another possible explanation for the lack of a clear association between WRKY genes and a specific phenotype was proposed by Ülker and Somssich [6] who demonstrated that in parsley several WRKY transcription factors, by binding to W-box in the same promoter, are involved in regulating expression of one or more target genes. To understand the function of a single WRKY gene it is crucial to identify all the genes participating in the associated regulatory network. In the first attempt to unveil the network of WRKY genes involved in pathogen response using a microarray approach, Wang et al. [29] identified five WRKY genes (belonging to three different phylogenetic subgroups) involved in systemic acquired resistance.

To identify the OsWRKY genes involved in response to Magnaporthe infection and osmotic stress, and to ascertain the existence of co-expression gene clusters, a custom WRKY specific oligo array was designed. Hybridisation results highlighted the involvement of OsWRKY genes that were differentially regulated in conditions of biotic and/or osmotic stress. Some of these genes were co-expressed, suggesting a possible co-regulation in the same signal transduction pathways. We also performed a Pearson Correlation Coefficient (PCC) analysis using public Arabidopsis Affymetrix expression data, which is the largest and most reliable transcriptome dataset available. Two main co-regulatory networks were identified, one of which contains many of the AtWRKY genes known to be involved in response to pathogens. The different sets of co-expressed WRKY genes described in rice and Arabidopsis contained a significant number of phylogenetically distantly-related genes. The power of the described approach was validated by the Pearson Correlation analysis of the MADS-BOX genes which correctly identified most members shown to belong to the major network controlling floral patterning and differentiation. Our results revealed the usefulness of characterizing co-regulatory networks to identify potential novel candidate genes cooperating in the same biological processes or signal transduction pathways. These candidates will, then, need to be experimentally tested at the functional level.

Results

WRKY proteins have been previously studied in a wide range of plant species [5,8,16,19,36] and shown to be involved in the regulation of several cellular processes, such as control of metabolic pathways, drought, heat shock, senescence, development and hormone signalling. However, the most studied role of this gene family appears to be in response to biotic and abiotic stress stimuli. The main goal of the work presented here was to perform a whole gene family transcription analysis of the rice and Arabidopsis WRKYs to identify those that are co-expressed in biotic and abiotic stress responses and that are potentially part of common signal transduction co-regulatory networks.

Phylogenetic analyses of rice WRKY gene family

One hundred and four WRKY genes were identified in the rice genome by searching TIGR release 5 database using the PFAM ID PF03106 and Genbank using tblastn with the consensus WRKY domain as the query sequence (see Methods). Manual inspection of the results obtained was performed to eliminate duplicated entries [see Additional file 1]. Phylogenetic analysis performed with the Maximum Likelihood method using all 104 proteins containing a single or double WRKY domain, divided the genes into 5 main phylogenetic groups (Figure 1). Additional sub-groups and smaller clades were identified within each group, based upon bootstrap values. The OsWRKY genes containing two domains (see OsWRKY names ending with N and C) represented two distinct clades of the same phylogenetic main group (see Figure 1). Bootstrap values of some nodes of the tree were found to be moderately low; this finding in the global OsWRKY analysis was not completely unexpected due to the low degree of conservation, short length of the WRKY domain and to the large size of the OsWRKY gene family. To attempt to improve the bootstrap values it would be necessary to align longer sequence stretches, but this approach would not be of help for WRKY genes as, outside the WRKY domain, amino acid sequences are poorly conserved.

Additional file 1. OsWRKY gene list. List of the retrieved 104 OsWRKY genes with their corresponding gene names used in this article together with their ID used for the OsWRKYARRAY microarray analysis. Gene locus in TIGR nomenclature (release 5) and names provided in earlier publications are reported.

Format: XLS Size: 30KB Download file

This file can be viewed with: Microsoft Excel ViewerOpen Data

thumbnailFigure 1. Phylogenetic tree of rice OsWRKY whole gene family. Phylogenetic tree of rice WRKY proteins. The tree was obtained on the basis of WRKY domain sequences of the 104 rice WRKY protein sequences with the Maximum Likelihood method using PHYML [68]. Both the N and the C WRKY domains were considered for those proteins bearing two domains. Bootstrap values higher than 50 are indicated in the nodes. Letters indicate the nine clusters of co-expressed genes, as presented in Figure 2 and Figure 3. The tree image was produced using iTOL software [69].

To reconstruct the evolutionary relationships of WRKY genes in rice and Arabidopsis, a phylogenetic tree was built using all of the WRKY domain sequences from the two species. Our analysis is in good agreement with the classification reported by Eugelm et al. [9] in Arabidopsis [see Additional file 2]. The Os-AtWRKY tree obtained in this study suggests a further division of group 3 into three distinct sub-groups: 3A, 3B, 3C [see Additional file 2]. More precisely, the presence of a sub-group containing only Arabidopsis WRKY genes (3A) was observed, a second one including only OsWRKY genes (named 3C) and a third one (3B) containing the remaining genes. This partition is likely to be the consequence of a series of species-specific duplication events in the OsWRKY 3 group, which occurred after the separation of Monocotyledons from Dicotyledons [35] and that are well documented in rice [18,37]. These events led to the great expansion of the rice WRKY group 3, to a total of 36 genes which represent 35% of the OsWRKY gene family.

Additional file 2. Arabidopsis - rice WRKY phylogenetic tree. Phylogenetic tree of rice and Arabidopsis WRKY domains obtained with the Maximum Likelihood method using PHYML [68]. Both the N and the C WRKY domains were considered for those proteins bearing two domains. Bootstrap values higher than 50 are indicated on the nodes. The sequences of Giardia lamblia, Dictyostelium discoideum and Chlamydomonas reinhadrtii were included. The tree image was produced using iTOL software [69]. The three distinct sub-groups of group 3 identified in this study are indicated as 3A, 3B and 3C.

Format: PDF Size: 366KB Download file

This file can be viewed with: Adobe Acrobat ReaderOpen Data

Rice WRKY whole gene family transcriptome analysis

A custom 60-mer oligo array (OsWRKYARRAY) was developed for rice WRKY gene family transcriptome analysis. This array contained the complete set of OsWRKY gene-specific probes based upon the hundred and four known genomic sequences [see Additional file 3]. RNA samples isolated from leaves and roots of two week-old rice plants following biotic or abiotic stress treatments were used for hybridisation on the OsWRKYARRAY. The expression of the 104 OsWRKY genes was assessed in the following conditions: 1) upon inoculation of leaves with one Magnaporthe oryzae isolate from rice, FR13, and two non-rice Magnaporthe isolates, M. oryzae BR32 from wheat and M. grisea BR29 from crabgrass; 2) upon application of osmotic stress in hydroponic conditions. Considering that fungal appressoria take about 16 hours to penetrate a rice leaf epidermal cell [38], leaf samples were collected 24 hours post inoculation (hpi) with the three Magnaporthe strains. The aim of this experiment was to assess early rice responses to fungal infection. RNA purified for these experiments came from the same batch of rice plants used for the cytological and molecular characterization of rice-Magnaporthe interactions described in Faivre-Rampant et al. [39]. For the study of OsWRKY gene expression upon osmotic stress conditions, samples were collected 1 hour (roots) and 5 hours (leaves and roots) after osmotic treatment. Gene expression results obtained from OsWRKYARRAY hybridisation experiments are reported in Table 1 and Figure 2. OsWRKY genes were considered to be up or down regulated when the logarithm values of the ratio of expression levels between treated and control RNA were higher than 0.2 or lower than -0.2 with the associated corrected P-value < 0.05. The analysis of differentially expressed OsWRKY genes revealed that 24 (22% of the total) were differentially regulated (down or up) in at least one of the six tested stress conditions (Table 1). Interestingly, among these 24 rice WRKY genes, gene expression of eight (OsWRKY4, OsWRKY18, OsWRKY61, OsWRKY19, OsWRKY37, OsWRKY112, OsWRKY43 and OsWRKY100) changed in response to both biotic and osmotic stress stimuli (in bold in Table 1). A few genes appeared to be differentially regulated only in a limited number of stress conditions, such as OsWRKY110, OsWRKY87, OsWRKY27, OsWRKY64 (see blue dots in Figure 2). OsWRKY110 was induced by FR13 infection, but repressed upon osmotic stress in leaves. OsWRKY87 was up regulated by BR32, whereas it was down regulated at late stage in both osmotic-stressed roots and leaves. OsWRKY27 is up regulated by BR29 and upon osmotic stress, but only in roots at 1 hpi. Finally OsWRKY64 was repressed by BR32 and induced only in roots by osmotic stimuli at an early stage. In addition, four genes OsWRKY6, OsWRKY115, OsWRKY69 and OsWRKY31 were differentially-regulated only in one stress condition (see yellow dots in Figure 2).

Table 1. List of differentially regulated OsWRKY genes upon pathogen and osmotic stress

thumbnailFigure 2. Clustering of OsWRKY genes according to their expression profiles in the OsWRKYARRAY. The OsWRKYARRAY was constitued of 104 probesets representing all members of the rice WRKY gene family. The expression of the 104 OsWRKY genes was assessed upon inoculation with Magnaporthe oryzae isolate from rice (FR13), M. oryzae BR32 from wheat, M. grisea BR29 from crabgrass and upon application of osmotic stress (mannitol) in hydroponic conditions. Panel A T-test P-values (shown by a green - black gradient) of treated vs control of the corresponding ratios shown in Panel B. The range of log transformed P-values comprised values between 0.01 (green) and 1 (black). P-values lower than 0.01 were visualized as 0.01. Panel B log2(Treated/Control) ratio values (shown by a green - magenta gradient). Red boxes with capital letters from A to F highlight the presence of co-expressed WRKY gene clusters. A blue dot indicates a OsWRKY gene differentially-regulated in two different stress conditions; a yellow dot indicates a OsWRKY gene-differentially regulated only in one stress condition. See Table 1 for numeric values of differentially-regulated OsWRKY genes.

Additional file 3. OsWRKY microarray oligonucleotides. List of the set of oligonucleotides used for the OsWRKYARRAY microarray together with their ID and sequences.

Format: XLS Size: 30KB Download file

This file can be viewed with: Microsoft Excel ViewerOpen Data

Clustering analysis of the data obtained with the OsWRKYARRAY was performed to pinpoint genes with similar expression profiles between different stress conditions. This analysis highlighted the following points (see red boxes in Figure 2):

i) three clusters of genes co-expressed in all test conditions for biotic and osmotic stress. In cluster A (OsWRKY4, OsWRKY18, OsWRKY61) and B (OsWRKY19, OsWRKY37, OsWRKY112) genes are up regulated after infection with all 3 Magnaporthe strains, but repressed upon osmotic stress treatment, in leaves and in roots. In contrast, in the small cluster C, genes OsWRKY100 and OsWRKY43 are down regulated after Magnaporthe interactions, but induced in roots and leaves after osmotic stress stimuli.

ii) three clusters of genes differentially expressed specifically upon one Magnaporthe interaction. Genes OsWRKY48, OsWRKY86 and OsWRKY40 (Cluster D) are induced after infection with M. oryzae BR32, while OsWRKY71 and OsWRKY79 (Cluster E) with M. grisea BR29. The remaining cluster F includes OsWRKY38, OsWRKY11 and OsWRKY53 genes, which are down regulated by Magnaporthe oryzae strain FR13.

To broaden the WRKY gene family expression profile obtained with the OsWRKYARRAY, WRKY expression data from the 22 K NIAS array (National Institute of Agrobiological Sciences) were extracted to highlight those genes that are co-expressed in a wider range of abiotic stress conditions, as well as at different developmental stages (shoot, meristem, panicle). Since in the 22 K NIAS array, only a subset of 50 WRKY genes is present (out of 104 of the whole gene family), a separate clustering analysis was performed (Figure 3). The gene expression data analysis was carried out using the same rationale as was applied to the OsWRKYARRAY (logarithm values of the ratio higher than 0.2 or lower than -0.2 and associated corrected P-value < 0.05). The 22 K NIAS gene expression data confirmed the correlation between OsWRKY18 and OsWRKY4 (see cluster A in Fig 2), and extended the clustering to the OsWRKY22, OsWRKY100, OsWRKY53, OsWRKY78 and OsWRKY84 genes (see Cluster I in Figure 3). These seven OsWRKY genes were found to be co-expressed in most conditions tested (e.g. flooding, drought and cold treatments) and in different plant organs (root, meristem, callus, panicle). This analysis revealed two additional clusters of co-expressed OsWRKY genes that were not identified by the OsWRKYARRAY analysis. Genes in cluster G, OsWRKY24, OsWRKY8, OsWRKY42 and OsWRKY3 are co-expressed in cold and drought conditions. Cluster H is constituted by the two genes OsWRKY96 and OsWRKY50, which have similar regulation profiles in flooding, cold and drought conditions.

thumbnailFigure 3. Clustering of OsWRKY genes according to their expression profile in the NIAS 22 K array. Clustering of the 50 OsWRKY genes present in the NIAS 22 K array according to their expression profiles in 30 experiments (upon abiotic stress conditions and in different plant tissues) was performed. Panel A T-test P-values (shown by a green - black gradient) of treated vs control of the corresponding ratios shown in Panel B. The range of log transformed P-values comprised values between 0.01 (green) and 1 (black). P-values lower than 0.01 were visualized as 0.01. Panel B log2(Treated/Control) ratio values (shown by a green - magenta gradient). Red boxes with capital letters from G to I highlight the presence of co-expressed WRKY gene clusters.

Our findings are partially supported by previous comprehensive gene expression analysis of OsWRKY genes [23,40]. Ryu et al. [23], analysed the OsWRKY gene expression after infection with different pathogens (Magnaporthe strains and Xanthomonas oryzae pv oryzae) and treatment with hormone signalling molecules. Overall, between the two studies there is agreement for fifty percent of the genes identified as being differentially expressed upon Magnaporthe infection. It is important to stress that the cultivars (indica vs japonica varieties), pathogen strains, and plant-pathogen interactions (virulent/avirulent vs compatible/multi-avirulent/non host) used in the two studies were different, making difficult a direct comparison of the obtained gene expression results. The WRKY genes found to be induced only in one of the studies may reflect the existence of different responses to pathogen attacks and/or adaptation to different environmental conditions; these data may be pertinent to define the evolutionary history between different rice cultivars and their responses to the same pathogens. In a recent work [40], the OsWRKY gene family was analysed under different abiotic and phytohormone treatments and the authors showed that several OsWRKY genes were co-expressed at the tested conditions (cold, salt, drought, phytohormones). Interestingly, OsWRKY4, OsWRKY43, OsWRKY61, OsWRKY53, OsWRKY63 and OsWRKY100 were found to be co-regulated upon different abiotic stress conditions, as well as in our experiments.

Comparing phylogenetic relationships and microarray-based gene expression clusters it was observed that the following pairs of closely related genes (OsWRKY18 and OsWRKY4 in cluster A, OsWRKY71 and OsWRKY79 in cluster E, OsWRKY100 and OsWRKY53 in cluster I) were co-expressed, reflecting recent duplications and potentially functional redundancy (see Figure 1). However, seven out of the nine identified clusters of co-expressed OsWRKYs contained sets of genes clearly belonging to different phylogenetic groups (see Figure 1). These findings suggest the existence of "complex networks" of OsWRKY genes contributing to orchestrate specific signal transduction pathways.

Validation of OsWRKYARRAY by quantitative RT-PCR

To validate the results obtained with the OsWRKYARRAY, quantitative RT-PCR analysis (Q-PCR) of 58% (14 out of 24) of the differentially expressed rice WRKY genes was performed (13% of the whole gene family), to confirm their level of expression in leaves after Magnaporthe infection and osmotic stress treatment. The following fourteen genes were chosen for Q-PCR assays: OsWRKY18, OsWRKY4, OsWRKY61, OsWRKY112, OsWRKY100, OsWRKY43, OsWRKY40, OsWRKY71, OsWRKY101, OsWRKY63, OsWRKY53, OsWRKY87, OsWRKY64 and OsWRKY115. Quantitative expression of these genes was measured in samples obtained from new independent experiments carried out at the same conditions as were used to obtain RNA samples for the OsWRKYARRAY transcriptome analysis. RNA was extracted from leaves 24 hours after inoculation with the same three fungal strains that were used for the microarray experiments (Magnaporthe BR29, BR32 and FR13) and 5 hours post osmotic treatment, respectively. Results of the Q-PCR experiments from the four test conditions (three biological replicates/treatment) are reported in Table 2 and showed that eleven out of the fourteen tested genes (80%) were confirmed as differentially expressed with the associated P-value < 0.05. The Q-PCR data of three genes (OsWRKY43, OsWRKY101 and OsWRKY115) were not in agreement with those obtained in the microarray analysis. In conclusion, Q-PCR analyses confirmed the robustness of microarray results and validated our hypothesis of the existence of co-expressed cluster of OsWRKY genes. In particular, Q-PCR results confirmed that OsWRKY4, OsWRKY18 and OsWRKY61 (see cluster A in Figure 2) have very similar expression profiles, in agreement with the existence of OsWRKYs co-regulatory networks. Based upon these data, we decided to characterize in detail the occurrence of WRKY networks in the model plant Arabidopsis thaliana.

Table 2. Microarray validation by quantitative RT-PCR

WRKY co-regulatory networks

The integrated transcriptome results indicated that specific clusters of co-expressed rice WRKY genes are involved in response to a range of applied stress conditions. The clusters A, E and F comprised mostly OsWRKY genes belonging to the same phylogenetic groups and often closely related. These genes are likely to be derived from recent duplication events and, therefore, as it may be expected, to share similar expression profiles. On the other hand, the clusters B, C, D, G and H mainly consisted of members of distinct phylogenetic groups. The largest cluster (I) included both distantly-related and closely-related OsWRKY genes (see Figure 1).

To further investigate clusters of co-expressed WRKY genes in plants, data were collected from 2,000 Arabidopsis Affymetrix microarray experiments and correlation analysis based on the Pearson Correlation Coefficient (PCC) was carried out; scatterplots of individual gene pairs were obtained, as previously described by Toufighi et al. 2005 [41]. A scatter plot of the results obtained with two non-correlating (AtWRKY35 vs AtWRKY40) and two correlating (AtWRKY33 vs AtWRKY40) genes is presented in Additional file 4. The source and the processing of the gene expression data were described in detail in Menges et al. [42], but a new matrix was generated for this study. For every AtWRKY gene on the At Affymetrix microarray (61 out of the 74 WRKY genes present in the Arabidopsis genome), we calculated the untransformed PCC value (P-lin) with each of the other members of the gene family [see Additional file 5]. In the logarithm analysis (P-log), the gene expression data were transformed into logarithmic values before calculating the PCC [see Additional file 6]. We performed both P-lin analysis to pinpoint co-regulatory patterns occurring in only few microarray experiments (e.g. tissue- or condition-specific expression) and P-log analysis to better define the WRKY co-regulation in the presence of very different gene expression levels between the gene pairs under examination. To define the existence of AtWRKYs co-regulatory networks, values of Pearson Correlation Coefficient higher or equal to 0.6 were considered as significant both for the topology of the networks and for the number of represented genes. To validate the PCC threshold value used to obtain AtWRKYs co-regulatory networks, PCC analysis of the AtMADS-BOX gene family was also carried out. As for the topology, the appropriateness of using the 0.6 threshold value was confirmed by plotting the number of edges and the mean of edges/gene as a function of the threshold values [see Additional file 7]; this analysis clearly highlighted that, taking a threshold value of 0.7, the mean number of edges/gene significantly dropped by 30%, losing important information about the complexity of the network. In addition, by plotting the number of edges and number of genes as a function of the threshold values [see Additional file 8], it was observed that the number of genes is reduced by 30% in the P-lin and by 39% in the P-log analysis. Moreover, the number of edges dropped by 59% in the P-lin analysis and by 70% in the P-log analysis, when the threshold value was raised from 0.6 to 0.7. As a further supporting evidence the AtMADS-BOX PCC analysis was performed at 0.6 and 0.7 threshold value [see Additional file 9 and 10], as this gene family is experimentally well characterized at the molecular and genetic levels. This analysis revealed that the network of the AtMADS-BOX genes (involved in floral differentiation) is very robust, with 13 genes in the P-lin analysis with threshold value > 0.6 [see Additional file 9] linked by 40 edges, 32 of which are backed up by molecular evidence for direct interaction (e.g. two hybrid, co-IP) or for involvement in ternary or quaternary complexes [43,44]. Moreover, 5 out of the 8 interactions lacking direct molecular evidence involved SEP2 which is an auto-activator in the two-hybrid assay and, therefore, could not be tested as bait. Two other separate networks of MADS-BOX genes were identified from our PCC analysis, which were backed up by molecular or genetic evidence: one network comprised AGL18, -29, -30, -65, -66 and -104 implicated in pollen maturation [45] and the second one AGL67, -68, MAF4, MAF5 and FLF involved in flowering transition [46]. The P-lin networks obtained with threshold value of 0.7 [see Additional file 9] loses experimentally supported connections such as AP1 with P1 and AP3/SP3 with SHP1. In addition applying the threshold value of 0.7, SEP4 is absent in the main AtMADS-BOX network and the MAF5 gene is missing in the flowering one. The P-log analysis with threshold value of 0.6 [see Additional file 10] keeps the same general topology as the P-lin one, albeit with a slightly reduced complexity (with 10 genes and 25 edges), whereas results obtained from the P-log analysis with threshold value of 0.7 [see Additional file 10] reduces dramatically the number of genes and networks which are mostly experimentally validated. These data clearly showed that, carrying out the PCC analysis with a threshold value of 0.7, the number of genes represented in the network decreases significantly, and confirmed the appropriateness of using the 0.6 threshold value.

Additional file 4. AtWRKY genes scatter plots. Typical scatter plot of the expression level of two pairs of AtWRKY genes across the set of Arabidopsis microarray experiments used for the Pearson Correlation Coefficient analysis. Each grey dot represents the simultaneous expression level of the two genes in one microarray experiment. A: The expression level of AtWRKY40 is not correlated with the expression of AtWRKY35. B: A strong correlation is present between AtWRKY40 and AtWRKY33.

Format: PNG Size: 213KB Download fileOpen Data

Additional file 5. Linear Pearson Correlation Matrix of AtWRKY genes. Correlation matrix of the untransformed Pearson Correlation Coefficient (PCC) values of the set of AtWRKY genes under examination.

Format: XLS Size: 86KB Download file

This file can be viewed with: Microsoft Excel ViewerOpen Data

Additional file 6. Logarithmic Pearson Correlation Matrix of AtWRKY genes. Correlation matrix of the logarithmic-transformed Pearson Correlation Coefficient (PCC) values of the set of AtWRKY genes under examination.

Format: XLS Size: 86KB Download file

This file can be viewed with: Microsoft Excel ViewerOpen Data

Additional file 7. Plot of edges and mean of edges/gene vs PCC threshold value. Plots of the number of edges (Y axis on the left) and mean of edges/gene (Y axis on the right) as a function of the PCC threshold values in the linear Pearson Correlation Coefficient analysis (P-lin) of the Arabidopsis MADS-BOX (above) and WRKY (below) genes.

Format: PNG Size: 23KB Download fileOpen Data

Additional file 8. Plot of edges and number of genes vs PCC threshold value. Plots of the number of edges and number of genes as a function of the PCC threshold values in the P-lin linear (above) and log-transformed (below) Pearson Correlation Coefficient analysis of the Arabidopsis WRKY (AtWRKY) genes.

Format: PNG Size: 21KB Download fileOpen Data

Additional file 9. P-lin co-regulatory networks of Arabidopsis MADS-BOX genes. Co-regulatory networks of Arabidopsis MADS-BOX genes obtained using untransformed Pearson Correlation Coefficient analysis (P-lin analysis). A: PCC threshold value of 0.6 B: PCC threshold value of 0.7. Unbroken lines indicate experimentally validated edges reported in literature; broken lines indicate edges not yet experimentally validated. The thickness of the edges is proportional to the value of the Pearson Coefficient. Thick black line: Pearson Correlation Coefficient 0.96; Thin Black Line: Pearson Correlation Coefficient 0.6 (in panel A) and 0.7 (in Panel B); the proximity of two genes on the graph is not indicative of their relatedness.

Format: PNG Size: 303KB Download fileOpen Data

Additional file 10. P-log co-regulatory networks of Arabidopsis MADS-BOX genes. Co-regulatory networks of Arabidopsis MADS-BOX genes obtained using log-transformed Pearson Correlation Coefficient analysis (P-log analysis). A: PCC threshold value of 0.6 B: PCC threshold value of 0.7. Unbroken lines indicate experimentally validated edges reported in literature; broken lines indicate edges not yet experimentally validated. The thickness of the edges is proportional to the value of the Pearson Coefficient. Thick black line: Pearson Correlation Coefficient 0.96; Thin Black Line: Pearson Correlation Coefficient 0.6 (in panel A) and 0.7 (in Panel B); the proximity of two genes on the graph is not indicative of their relatedness.

Format: PNG Size: 193KB Download fileOpen Data

P-lin analysis of AtWRKY genes revealed the existence of two major co-regulatory networks (COR-A and COR-B) and of two additional smaller networks COR-C and COR-D (Figure 4A). The P-log analysis confirmed the existence of the two interconnected COR-A and COR-B clusters (Figure 4B) while the other two smaller networks were not present. Taken together, the P-log and P-lin analyses revealed that more than 70% (45 out of 61) of the Arabidopsis WRKY genes analysed are co-regulated with other WRKYs [see Additional file 11]. The existence in COR-A of a sub-cluster constituted of AtWRKY70, AtWRKY38, AtWRKY46 and AtWRKY54 co-regulated genes in both P-lin and P-log analyses, was experimentally proven by Kalde et al. [22]. In the P-lin analysis the genes AtWRKY70, AtWRKY38, AtWRKY46 and AtWRKY54 are clustered together, whereas, AtWRKY30 and AtWRKY55 are apart, although they belong to the same group 3. This is in agreement with the results by Kalde et al. [22], who showed that the former four genes are induced by salicylate and pathogens, whereas the latter two are not differentially expressed at the same conditions. Moreover, the implication of the strongly co-regulated AtWRKY25 and AtWRKY33 genes (P-lin value 0.74) in the same signal transduction pathways and the functional redundancy of AtWRKY11 and AtWRKY17 (P-lin value 0.63) were reported by Andreasson et al. [47] and Journot-Catalino et al. [48], respectively. It is noteworthy to highlight that in the AtWRKY PCC analysis using a threshold value of 0.7 [see Additional file 12], the aforementioned subcluster of AtWRKY70, AtWRKY38, AtWRKY46 and AtWRKY54 genes and the connection between AtWRKY11 and AtWRKY17 were lost. As previously mentioned, P-lin analysis allowed us to highlight the existence of a correlation between two genes that are expressed in just a few conditions/treatments, while P-log highlights co-regulation between genes even in the presence of large differences in their expression levels. The small networks COR-C and COR-D were present only in the P-lin analysis (see Figure 4A), reflecting their co-expression only in few tested experimental conditions (data not shown). AtWRKY3 and AtWRKY4 genes (COR-D) were found to be specifically and rapidly induced upon infection with Botrytis cinerea and the virulent P. syringae pv. tomato strain DC3000 (PstDC3000). As a supporting evidence of their restricted but correlated role, the wrky3wrky4 double mutant plants exhibited more severe disease symptoms only following Botrytis infection [49]. On the other hand, the P-log analysis (Figure 4B) revealed the co-regulation (P-log value 0.73) of two (AtWRKY18 and AtWRKY40) of the three WRKY genes belonging to the group 2A, previously shown to physically interact [28].

Additional file 11. List of Arabidopsis WRKY genes present in the co-regulatory. List of the Arabidopsis WRKY genes with their affiliation to the different co-regulatory networks according to the P-lin and P-log Correlation analysis (see Figure 4) and their assigned phylogenetic group (see Additional file 2).

Format: XLS Size: 19KB Download file

This file can be viewed with: Microsoft Excel ViewerOpen Data

Additional file 12. Co-regulatory networks of Arabidopsis WRKY genes. Co-regulatory networks of Arabidopsis WRKY genes obtained with the PCC threshold value of 0.7 in the untransformed (P-lin) (panel A) and log transformed (P-log) Pearson Correlation Coefficient analysis (panel B). The thickness of the edges is proportional to the value of the Pearson Correlation Coefficient. Thick black line: Pearson Correlation Coefficient 0.96; Thin Black Line: Pearson Correlation Coefficient 0.7. The proximity of two genes on the graph is not indicative of their relatedness.

Format: PNG Size: 255KB Download fileOpen Data

thumbnailFigure 4. Co-regulatory networks of Arabidopsis WRKY genes. For each pair of WRKY genes, the Pearson Coefficient was calculated on untransformed values P-lin (see Panel A) and on log-transformed values P-log (see Panel B) to measure the correlation of expression levels, based on 2,000 Arabidopsis microarray experiments. Each pair of correlated WRKY genes (Pearson Correlation Coefficient value higher than 0.6) are shown in the figure with an edge connecting them. The thickness of the edges is proportional to the value of the Pearson Correlation Coefficient. Thick black line: Pearson Correlation Coefficient 0.96; Thin black line: Pearson Correlation Coefficient 0.6. Proximity of two genes on the graph is not indicative of their relatedness. The colours indicate different phylogenetic groups. See Additional files 5 and 6 for the specific numeric values of the P-lin and P-log correlation coefficient, respectively. The four identified co-regulatory neworks were indicated as: COR-A, COR-B, COR-C and COR-D.

In conclusion, our approach is validated by the presence in the COR-A and COR-B networks of recently duplicated genes tightly co-regulated not only in silico but also in vivo. Our work revealed that both COR-A and COR-B networks included significantly co-regulated WRKY genes belonging to distinct phylogenetic groups (see Figure 4 and Additional file 11); the WRKY PCC analysis is a valuable tool to unveil novel co-regulatory pathways between WRKY genes in plants.

Integration of rice co-expression clusters and Arabidopsis WRKY co-regulatory networks

We attempted to link rice co-expression clustering data to Arabidopsis co-regulatory pathways and vice versa by search for respective orthologs. We used GreenPhylDB [50] to search for pairs of rice-Arabidopsis orthologs in the WRKY gene family with a bootstrap value greater than 50%. By this analysis we identified the following conserved WRKY networks between rice and Arabidopsis (see Table 3):

Table 3. Rice - Arabidopsis orthologs in WRKY co-regulatory pathways

- the Arabidopsis orthologs (AtWRKY18, AtWRKY40 and AtWRKY33) of the three rice genes of cluster A in the OsWRKYARRAY (OsWRKY61, OsWRKY4 and OsWRKY18) were significantly connected in the COR-A network. In particular, the two orthologs, AtWRKY18 and AtWRKY40, were connected in P-log analysis and, as aforementioned, it was reported that they physically interact in vitro and in vivo [28].

- the Arabidopsis orthologs (AtWRKY46, AtWRKY70/AtWRKY54) of the two rice genes of cluster E (OsWRKY71 and OsWRKY79) were found to be connected within the COR-A network; these findings were experimentally supported by their very similar profiles of gene expression upon pathogen attack [22].

- the six genes belonging to the rice co-expression cluster I (OsWRKY4,-18,-22,-53,-78,-100) had all Arabidopsis orthologs belonging to COR-A; five of these identified AtWRKY orthologs were directly pairwise connected within the COR-A network.

As regards to the remaining rice WRKY genes shown to be part of co-expression clusters, in most cases, it was not possible to find their respective orthologs in Arabidopsis. In particular, four of them belong to the OsWRKY 3C group, which has not orthologs in Arabidopsis [see Additional file 2]. The role of these WRKY genes and of the 3C rice-specific phylogenetic group in defence related signalling pathways deserves further investigations at the functional level.

Discussion

Rice co-expression WRKY clusters

In the present work we carried out whole OsWRKY gene family transcriptome analysis upon Magnaporthe infection and osmotic stress treatment to identify clusters of genes differentially co-expressed upon biotic and abiotic stress conditions.

The genes OsWRKY6, -18, -61, 71, found to be differentially expressed in the OsWRKYARRAY experiments, were previously described as being involved in biotic and abiotic stress responses [51-54]. In particular, OsWRKY18, which resulted to be significantly regulated in our biotic/abiotic stress experiments, was reported as being modulated in roots during microbial colonization [55], after application of salicylic acid, methyl jasmonate, 1-aminocyclo-propane-1-carboxylic acid and in response to both wounding and pathogen infection [52].

To extend our transcriptome analysis we took advantage of a large set of gene expression data extrapolated from the 22 K NIAS array experiments. By integrating the data from both microarrays, nine co-expression WRKY gene clusters were identified (see Figures 2 and 3), some of them restricted to specific experimental conditions, while others found in a larger set of them. Despite the relatively low ratios of the expression levels in both rice microarray experiments of the differentially-regulated WRKY genes, the majority of them were confirmed by qRT-PCR analyses. In fact, most plant transcriptional factors are tightly and, often, only transiently up- or down-regulated upon stress stimuli making it difficult to capture their peak of induction/repression [56-58]. Moreover, in the case of infection with fungal pathogens, as Magnaporthe, only a few cell layers (e.g. epidermal cells) are implicated in the plant responses [38], while gene expression studies rely on bulked leaf material, causing a "dilution" effect of the detected gene expression levels [59,60]. In a number of cases only in situ hybridisation or laser capture microdissection (LCM) coupled with microarray experiments revealed the exact gene expression patterns of specific members in transcriptional factors gene families (e.g. MADS-BOX genes in ovules, meristem) [61,62]. Recently, LCM technology was also successfully applied to the study of plant-microbe interactions [63].

The integration of the gene expression clusters to the phylogenetic data of the whole OsWRKY gene family (see Figure 1) highlighted that also genes belonging to clearly distinct clades were significantly co-expressed. Closely-related OsWRKY genes, likely to be derived from recent duplication events, were found to be tightly co-regulated; this was expected, since it was shown that recently duplicated WRKY genes often keep the same role in signal transduction, representing a typical case of functional redundancy [37]. On the other hand, the OsWRKY CORs would indicate the existence of WRKY protein complexes where WRKYs belonging to different subgroups bind to different cis-regulatory elements, thus giving them different targets that are expressed under the same conditions, tissue and timing. The identification of co-regulated WRKY genes would allow researchers making more-informative choices of double and triple mutant combinations to circumvent redundancy or test for potential protein-protein interactions to functionally investigate the relevance of specific WRKY complexes in pathogen resistance, tolerance to abiotic stress, hormonal balance and plant development.

At WRKY co-regulatory networks

To address the existence of co-regulatory pathways of phylogenetically unrelated WRKY genes in plants we carried out Pearson Correlation Coefficient (PCC) analysis of Arabidopsis Affymetrix transcriptome data from 2,000 experiments. All Affymetrix array experiments were carried out by the same laboratory (NASC) with standardized normalization process thus facilitating the creation of robust and reliable PCC matrices. The generated matrices for AtWRKY genes using both untransformed [see Additional file 5] and logarithm-transformed [see Additional file 6] expression data were analysed at different threshold values of PCC. The appropriateness of the applied threshold value of 0.6 was validated using the set of available data for the MADS-BOX gene family of transcription factors [see Additional file 7, 8]. We took advantage of the in-depth knowledge of the MADS-BOX signal transduction pathways and protein-protein interactions to validate the factual existence of the correlations identified in our PCC approach. In most cases the identified co-regulatory edges well reflected the existing genetic evidences described in the literature. Moreover, most of the PCC-identified networks supports specific sets of MADS-BOX genes in the same signal transduction pathways and their tight co-expression in specific cell layers [64,65].

The PCC analysis (see Figure 4) highlighted the presence of two main interconnected co-regulatory networks of phylogenetically distinct AtWRKY genes (COR-A, COR-B). Such networks represent powerful tools to identify candidate partners of WRKY genes of interest or to investigate experimentally the existence of interactions between WRKY proteins in vivo (e.g. co-immunoprecipitation analysis). The presence in COR-A of AtWRKY18, AtWRKY40, -38, -46, -54, -70, 33 and -25 showed that the PCC approach was able to identify WRKY genes previously described as being part of a functional network involved in response to stress stimuli. In fact, AtWRKY18 and AtWRKY40 are pathogen-induced genes and known to physically interact [28]. AtWRKY38, AtWRKY46, AtWRKY54 and AtWRKY70 are also pathogen-induced genes and three of them are known to act in the same regulatory pathway. Moreover, the application of salicylic acid to wrky54 mutants altered the expression patterns of AtWRKY38 and AtWRKY70 genes [22]. The COR-A network also included AtWRKY genes found to be involved in Systemic Acquired Resistance (SAR) by Wang et al. [29], in a study aimed to identify targets of NPR1, an essential regulator of plant SAR. Among these targets, the authors found eight AtWRKYs of which five were shown to be part of the complex transcriptional regulatory network of SAR. In our PCC analysis of AtWRKY networks, four of these five genes (AtWRKY18, -54, -53 and -70) not only belonged to the same group (COR-A), but they were also tightly correlated (Fig 4A). In this study, the authors stated that, in addition to AtWRKY46, AtWRKY53, AtWRKY54, a related gene of AtWRKY70 is required to fully silence salicilate biosynthesis, yet to be identified. In both the P-lin and P-log analysis AtWRKY38 is significantly connected to these co-regulated genes and, therefore, it may be the best candidate to be functionally characterized.

Most of the previously-mentioned genes were studied as they are phylogenetically related [22,28]. However, our PCC analysis of the AtWRKY genes suggested that the interaction in co-regulatory networks may occur also between phylogenetically unrelated WRKY genes, such as AtWRKY40, AtWRKY6, AtWRKY33 and AtWRKY46 belonging to different groups (2A, 2B, 1 and 3, respectively).

The topology of the COR-A network predicted the presence of further genes that could be involved in the same signal transduction pathway. A role for these genes in plant defence has yet to be defined, but according to the Pearson co-regulatory analysis they are interesting candidates to be tested at the genetic and biochemical level. Similarly, the co-regulatory network Cor-B indicated that several unrelated WRKY genes, functionally uncharacterized to date, are likely to interact among each other. Genetic analysis of those genes as part of a regulatory network rather than as single genes may give further insights into their function and role in specific signalling pathways. In COR-C the AtWRKY34 and AtWRKY42 genes were found to be strongly connected by a PCC value of 0.9; these two genes, together with AtWRKY31 were only seen in the P-lin analysis as their expression was found to be restricted only to a very specific plant tissue (data not shown). The COR-D network, only present in the P-lin analysis, was constituted of the three genes AtWRKY3, AtWRKY4 and AtWRKY32. While the genetic interaction between AtWRKY3 and AtWRKY4 both belonging to the phylogenetic group 1 was previously demonstrated [49], the association of the yet unassigned AtWRKY32 to the other two genes and its potential role in WRKY-mediated pathogen signal transduction pathways (e.g. resistance mechanisms to B. cinerea) remains to be elucidated. Our PCC analysis enables scientists to formulate new working hypotheses involving AtWRKY genes belonging to distinct phylogenetic groups to dissect specific regulatory pathways in plants.

Orthology rice - Arabidopsis

A large set of microarray data is vital to build up detailed and reliable co-regulatory networks. Among plants, this can be achieved, to date, only for Arabidopsis thaliana due to the large and consistent expression dataset. However, the Arabidopsis co-regulatory networks can be used as reference for other species where a smaller set of expression experiments is available. In addition, when information of orthology is available between Arabidopsis and another species, this approach can identify the existence of genes involved in a common biological process or extend their number, even if expression data are not sufficient to reveal the existence of co-regulatory networks [25]. This approach was proven to be successful and highly informative for OsWRKY genes in this study. In fact, we found 20 pairs of orthologous genes among rice and Arabidopsis and 8 of them were co-regulated in both species, integrating our microarray, Q-PCR and PCC results.

In summary, our first attempt to correlate specific OsWRKY co-expression clusters to AtWRKY-COR groups revealed the existence of one large (cluster I in rice) and two smaller (cluster A and E in rice) conserved co-regulatory networks between the two model plants. This will now open the route to test the functional conservation of the identified clusters of WRKY genes between the two species and their involvement in the same signal transduction pathways. However, the difficulty in finding orthologs between rice and Arabidopsis WRKY genes, due to successive rounds of duplications in both species and to the existence of Monocot and Dicot-specific phylogenetic clades, calls for the need to develop suitable transcriptome resources to carry out PCC analysis in rice. Only this systematic analysis will enable researchers to develop working hypotheses on co-regulatory signal transduction pathways of rice WRKY genes to be experimentally tested.

Conclusion

Ülker and Somssich [6] pointed out that to assign a specific function to members of this complex gene family "of imminent importance is to uncover WRKY-interacting proteins that assist in regulating the transcription of genes". Here we proposed a validated and innovative approach that aims at finding such interacting proteins relying not on their sequence similarity, but rather on co-regulation at the transcriptome level. Our integrated rice-Arabidopsis co-expression approach showed the existence of large co-regulatory networks of WRKY genes in plants. The PCC analysis revealed that closely-related AtWRKY genes, known to be involved in the same signal transduction pathways (and often functionally redundant), are also strongly co-regulated with other phylogenetically distantly-related members of the WRKY gene family. The in-depth analysis of WRKY COR networks will surely contribute to unveil the function of WRKY genes, as a more targeted genetic analysis will be possible on sets of candidate genes, shown to be significantly co-regulated. Moreover, the existence of complex regulatory pathways clearly supports the existence of cascades of WRKY signal transduction steps, as shown for MADS-BOX and MAP kinase genes [66], yet to be defined.

In conclusion our rice-Arabidopsis integrated approach strongly supports the existence of cross-regulatory pathways by WRKY genes possibly via specific feedback mechanisms, as recently highlighted by Pandey et al. [25].

The PCC analysis presented in this manuscript represents a powerful tool applicable to gene families of other classes of transcriptional factors, contributing to define regulatory networks in plants activated in response to biotic and abiotic stress stimuli.

Methods

WRKY gene sequences

Nucleotide sequences to design oligos have been retrieved searching for PFAM ID PF03106 as query in the Rice Annotation Release 5 at TIGR http://www.tigr.org/tdb/e2k1/osa1/domain_search.shtml webcite. The PFAM PF03106 is the name of the WRKY domain stored in the PFAM database, a large collection of protein domain families, which provides multiple sequence alignments and Hidden Markov Models (HMMs). When more than one alternative splicing sequence was found for the same locus, only the longest one was used. Further sequences previously found as WRKY gene in previous releases of TIGR but not confirmed in the last one were kept anyway. A search for WRKY genes not annotated as WRKY by TIGR was perform with tblastn on Genbank using the following consensus sequence: KPRFAFMTKSEVDILDDGYRWRKYGQKMIKNNPYPRSYYRCTMAKGCVKKQVERCSDDPIIVITTYEGQHNHPWP as a query filtering for E value < 10-13. A summary table specifying nomenclature used in this article of the retrieved 104 OsWRKY, gene locus in TIGR nomenclature and names provided in earlier publications [17,34] are reported in Additional file 1. For each gene, a gene-specific sequence of 60 nucleotides was designed generally in the 3' end of the gene and, in any case, out of the conserved domain. Four replicates of each oligo were spotted on slides together with oligos for positive, negative, and 7 housekeeping genes. A complete list of spotted genes and their sequences is provided in Additional file 3 and submitted on-line at GEO http://www.ncbi.nlm.nih.gov/geo/ webcite with this accession number: GSE5819.

Phylogenetic analyses

We based our evolutionary reconstruction of the WRKY family on the multiple alignment of the amino acidic sequence of the WRKY domains. We made two major reconstructions: one with all the rice members of the WRKY gene family and the second with all the WRKY domains of rice and Arabidopsis. In the latter, the non-plant sequences of Giardia lamblia, Dictyostelium discoideum and Chlamydomonas reinhadrtii were also included. The final set of proteins was composed of 122 sequences for the OsWRKY tree and of 204 for the Arabidopsis-Os WRKY tree. We built up a multiple sequence alignment (MSA) using MUSCLE [67] with the maximum number of iterations set to 1000. We derived Maximum Likelihood (ML) phylogenetic inferences using PHYML [68], applying the JTT matrix. Our model of sequence evolution assumed that there were two classes of sites, one class being invariable and the other class being free to change. The rate variation across these sites was assumed to follow a gamma shape distribution calculated using a discrete approximation with eight categories of sites. One hundred bootstrap replicates were used to support the hypotheses of relationships. The tree image was produced using iTOL [69].

Interaction with Magnaporthe grisea

Rice plants (Oryza sativa L. ssp japonica) cv. Nipponbare were grown from seeds in a greenhouse in trays of 40 × 29 × 7 cm filled with compost (7/8 Neuhaus compost N 9, 1/8 pouzzolane) under a 27°/22°C day/night temperature, 60% humidity. Twenty seeds were sown in rows with 6 rows per genotype. Nitrogen fertilization with 8.6 g of nitrogen equivalent was done at 7 and 2 days before inoculation. The same conditions were applied to control (mock) and infected plants.

Magnaporthe grisea isolate cultures

Three fungal isolates with different geographic origins were chosen from the Magnaporthe (Hebert) Barr strain collection (CIRAD, Montpellier). Magnaporthe oryzae FR13 is a rice isolate, Magnaporthe oryzae BR32 is a non-rice isolate from wheat and Magnaporthe grisea BR29 was isolated from crabgrass. These strains were cultured in Petri dishes containing 20 mL of medium composed with 20 g × L-1 rice seed flour, 2.5 g × L-1 yeast extract, 1.5% agar (Merck). After autoclaving, 500,000 units of Penicillin G (Sigma) were added aseptically by filter sterilizing. The cultures were then placed in a growth chamber with a 12 h photoperiod and a constant temperature of 25°C for 7 to 9 days prior to inoculation.

Inoculation

Conidia were harvested from plates by rinsing with sterile distilled water and filtering through two layers of gauze. Inoculations with Magnaporthe strains were performed with rice plantlets 2 weeks after sowing by spraying with conidial suspensions. Thirty mL of either a 100,000 (for FR13) or 300,000 (for BR29 or BR32) conidia × mL-1 suspension with 0.5% gelatin were sprayed on each tray (60 plants). Control plants were sprayed with a solution of water with 0.5% gelatin (mock-treated leaves). Treated and control rice plants were then kept together for 16 hours in a controlled climatic chamber at 25°C and 95% relative humidity. Leaf tissue was then harvested 24 hours after inoculation for total RNA extraction. To obtain RNA for the microarray experiments, each treatment was repeated twice on independent assays. Additional independent experiments were carried out in three biological replicates to obtain RNA for the Q-PCR and validate OsWRKYARRAY results.

Abiotic stress

Dehisced seeds from Nipponbare genotype were sterilized with 15% (v/v) sodium hypochlorite for 30 minutes and then rinsed with distilled water. Seeds were germinated in Petri dishes at 28°C on Whatman paper soaked in deionized water. After 4 days, rice seedlings were transferred in pots containing pouzzolane and allowed to growth under controlled conditions with a 28/25°C day/night temperatures, 12 hours photoperiod and 55-65% humidity for 2 weeks in Yoshida modified solution (Yoshida, 1981): 0.7 mM KNO3, 1.2 mM Ca(NO3)2, 1.6 mM MgSO4, 0.5 mM (NH4)2SO4, 0.8 mM KH2PO4, 60 μM FeEDTA, 20 μM MnSO4, 0.32 μM(NH4)6Mo7O24, 1.4 μM ZnSO4, 1.6 μM CuSO4, 45.2 μM H3BO3. Medium pH was adjusted to 5.0 twice a day. Seedlings at the 5 leaves stage without any visible tiller were carefully selected for stress treatments. For osmotic stress, 100 mM of mannitol was added in the hydroponic solution, whereas in the control (non-stressed) mannitol was not added to the solution. Root and leaf tissues were harvested 1 hour and 5 hours after the beginning of stress treatment. The harvested tissues were immediately frozen in liquid nitrogen and stored at -80°C. Tissues of control plants were collected at the same conditions and time as stressed plants. Each treatment was repeated twice, on independent assays for the microarray experiments. Additional independent experiments were carried out in two biological replicates, to obtain RNA for the qRT-PCR and validate OsWRKYARRAY results. Leaf samples from treated and control plants were harvested 5 hours after mannitol application.

RNA extraction

Each biological replicate was obtained by pooling three leaves (third leaf) harvested from three different plants (mock/infected) for each treatment. Total RNA of each biological replicate was purified, using the TRIZOL protocol (Invitrogen, Carlsbad, CA), following the manufacturer's instructions. Total RNA was quantified using a NanoDrop ND-1000 Spectrophotometer; RNA with an absorbance A260/A280 ratio > 2.0 was tested for quality and integrity using the Agilent 2100 Bioanalyzer (Agilent).

Microarray hybridisation

The customized OsWRKYARRAY microarrays were produced using a Virtek ChipWriter Pro contact printing robot. Hundred thirty oligos of 60-mers representing rice WRKY genes and positive and negative controls were printed onto Corning GAPSII (gamma amino propyl silane) slides at a final concentration of 20 μM. Ten μg of total RNAs were used for Cy3 or Cy5 labelling using the Cyscribe First-Strand cDNA labelling kit (Amersham). The labelled cDNA samples were purified using the CyScribe GFX Purification Kit (Amersham) and concentrated using a microcon YM-30 filter (Millipore). Five ng of Luciferase RNA (Promega) was added to each RNA sample prior labelling and used as spiking control. For array hybridisation, Cy3 and Cy5 labelled cDNA probes were mixed with Calf thymus DNA (Sigma) and EGT hybridisation buffer (Eurogentec) and hybridized to the microarray (Eurogentec) at 42°C in a humid chamber (Corning) for 16 hours. Arrays were washed 5 minutes in a 0.2×SSC-0.1% sodium dodecyl sulfate solution then 5 minutes in 0.2×SSC. The arrays were spin-dried and scanned using the Axon 4100A Scanner. The hybridisation data were collected using the GenePix Pro 3.0 software. Dye swaps for each experiment were performed and hybridisations repeated twice for experiments BR29, BR32, osmotic stress (leaves) at 5 hours, and for osmotic stress (roots) at 5 hours; only once for FR13 and osmotic stress (roots) 1 hour. Two biological replicates have been tested for each analysed condition. Three negative (Drosophila melanogaster lysozyme C, Drosophila melanogaster myosin 61F, Drosophila melanogaster Male-specific RNA 57Db), and four positive control (PR1 and PBZ1, dehydration-stress inducible protein and no apical meristem) were included. Housekeeping were the following genes: actin, zinc finger, cathepsin b-like cysteine proteinase, polyubiquitin, glyceralde-3-phosphate dehydrogenase, vacuolar proton-translocating ATP-ase subunit [see Additional file 3].

Microarray and clustering analysis

OsWRKY expression data were extracted from results of 30 hybridisation experiments with the 22 K NIAS array http://www.nias.affrc.go.jp/index_e.html webcite of which 17 were involving abiotic stress treatments; each value represents the mean of three independent hybridisation experiments. Both OsWRKYARRAY and NIAS 22 K microarray data were normalized using Limma [70] a package of the statistical software R, part of Bioconductor http://www.bioconductor.org/ webcite. Normalization on total signal was performed using the "loess function", but giving a differential weight (10 times higher) to housekeeping genes and DNA. A linear model was then applied to test the null hypothesis that the log of the ratio treatment/control was equal to 0. Associated P-values were corrected for false discovery rate [71]. For presence-absence of transcript, for every slide expression level (log of the average of two channels) of replicates of every gene was analysed with statistical T-test, if significantly different from expression level of negative control (Mst_57_Db, Myo61 and LysC). Genes which passed the test with a P-value < 0.001 were considered expressed. Raw data can be found at GEO (NCBI) with accession numbers GSE5819 (WRKYARRAY), GSE7531 and GSE7532 (NIAS). Clustering of rice data was performed using EPICLUST, a module of Expression Profiler http://www.bioinf.ebc.ee/EP/EP/ webcite. Default parameters were applied and a hierarchical clustering analysis was carried out using linear correlation based distance (Pearson) to calculate similarity matrix and UPGMA. Image of P-values were obtained using R on a computer with Ubuntu Linux installed.

Real-time quantitative RT-PCR

Leaf samples were obtained in new independent experiments carried out specifically to biologically validate OsWRKYARRAY results. The RNA (800 ng) was treated with the DNase I (Fermentas), and 500 ng of the treated RNA was reverse-transcribed with High Capacity cDNA Reverse Transcription Kit (Applied Biosystem) using an oligo(dT) primer following manufacturer's recommendations. The cDNA synthesis reactions were treated with RNAse H, diluted hundred fold in sterile water, and 2,5 μl of the diluted cDNA served as template for PCR. For quantitative PCR, 2× Power SYBR Green PCR Master Mix (Applied Biosystem) were used according to manufacturer's recommendations on a 7900HT Fast Real-Time PCR System using version SDS 2.2.2 software (Applied Biosystems) to analyse raw data. Specific primer pairs were designed for 14 WRKY full-length cDNAs using Primer3 software and ordered from Sigma-Aldrich Company Ltd. (Haverhill, UK). Primer specificity was assessed by sequencing PCR products. Primer sequences are shown in Additional file 13. The expression level of each gene was measured in leaf samples infected with the three Magnaporthe strains and after osmotic stress treatment (4 different conditions). Results with an associated P-value > 0.05 were considered not significant and therefore are not reported in Table 2. The PCR was carried out in a total volume of 10 μL containing 0.3 μM of each primer, 1× Power SYBR Green PCR Master Mix (Applied Biosystems). Reactions were amplified as follows: 95°C for 10 min, then 40 cycles of 95°C for 15 sec, 60°C for 1 min. The absence of genomic DNA and non-specific by-products of the PCR amplification was confirmed by analysis of dissociation curves. For each primer pair, appropriate calibration curves were first obtained with different dilutions (0.1, 0.04, 0.02, 0.01, 0.004, 0.002, 0.0010) and were accepted when the correlation coefficient was ≥ 0.99 and the efficiency between 95 and 105%. All calculations for relative quantification were performed as described in Pfaffl [72] using a mathematical model to determine the relative quantification of the target gene compared with the reference gene (actin) from an inoculated plant versus a control (mock) one. Statistical significance of the difference between mock and infected was assessed by T-test analysis.

Additional file 13. OsWRKY primer sequences used for quantitative RT-PCR analysis. The sequences of primers used to analyse the expression levels of 14 OsWRKY genes by quantitative RT-PCR analysis are listed.

Format: XLS Size: 17KB Download file

This file can be viewed with: Microsoft Excel ViewerOpen Data

Pearson correlation

Pearson correlation values were calculated essentially as described by Toufighi et al. [41] for the 'Expression Angler'. To this purpose a Visual C++ based program was developed (P. Morandini, L. Mizzi, unpublished) to calculate the correlation value from the data obtained with the ATH1 GeneChip from Affymetrix and deposited at the NASC array database http://affy.Arabidopsis.info/narrays/experimentbrowse.pl webcite as of September 2008. For the calculation of Pearson coefficient from log values, data were simply transformed into log before calculating the correlation value. From such values, networks of Arabidopsis WRKY genes were produced using the program dot http://citeseer.ist.psu.edu/gansner93technique.html webcite. The input text file for dot was prepared using a script that filtered WRKY genes with a reciprocal coefficient of 0.6 or higher from the complete table of Pearson coefficient. Intensity of arrow colours are proportional to the coefficient between each pair of WRKY genes. A more detailed explanation of the method used is reported in Menges et al. [42] in the section Global expression correlation analysis in Methods.

Authors' contributions

SB and PA drafted the manuscript. SB performed the sequence search, carried out the gene family annotation, analysed OsWRKYARRAY expression data with statistical analysis, performed gene clustering. PA performed the stress experiments to validate OsWRKYARRAY, carried out quantitative Q-PCR and relevant statistical analysis. OFR and AB performed the stress experiments, provided the RNA for microarray hybridisation. OFR critically revised the manuscript. IF carried out the phylogenetic and orthology analyses, producing OsWRKY and Os-At WRKY tree figures. LM carried out PCC analyses and edited co-regulatory networks for AtWRKY and MADS-BOX genes. KS contributed to gene expression analysis using 22 K rice oligo microarray system. SK critically revised the manuscript. PM calculated Pearson coefficient from Arabidopsis microarray data, analysed and described co-regulatory networks and critically revised the manuscript. MEP conceived the initial research project. PP supervised and coordinated all experimental and analytical activities that led to the present publication and curated the manuscript preparation and revision. All authors read and approved the final manuscript.

Acknowledgements

We would like to thank Dr. Hitomi Yamada-Akiyama, Dr. Hisako Ooka, Dr. Kimihisa Tasaki and Dr. Jung-Sook Lee; Toshifumi Nagata, Ramaswamy Manimekalai for their contribution in production of NIAS microarray data. Jordan H. Boyle, Amelia Waddington and John Williams for critically reviewing the manuscript. This work was supported by the EU 5th framework project QLG2-CT-2001-01453 Cereal-Gene Tags and by the Riceimmunity project funded by the Fondazione Cariplo.

References

  1. Willmott RL, Rushton PJ, Hooley R, Lazarus CM: DNase1 footprints suggest the involvement of at least three types of transcription factors in the regulation of alpha-Amy2/A by gibberellin.

    Plant Mol Biol 1998, 38(5):817-825. PubMed Abstract | Publisher Full Text OpenURL

  2. Yu D, Chen C, Chen Z: Evidence for an important role of WRKY DNA binding proteins in the regulation of NPR1 gene expression.

    Plant Cell 2001, 13(7):1527-1540. PubMed Abstract | Publisher Full Text | PubMed Central Full Text OpenURL

  3. Dong J, Chen C, Chen Z: Expression profiles of the Arabidopsis WRKY gene superfamily during plant defense response.

    Plant Mol Biol 2003, 51:21-37. PubMed Abstract | Publisher Full Text OpenURL

  4. Miao Y, Laun T, Zimmermann P, Zentgraf U: Targets of the WRKY53 transcription factor and its role during leaf senescence in Arabidopsis.

    Plant Mol Biol 2004, 55(6):853-867. PubMed Abstract | Publisher Full Text OpenURL

  5. Eulgem T, Rushton P, Schmelzer E, Hahlbrock K, Somssich I: Early nuclear events in plant defence signalling: rapid gene activation by WRKY transcription factors.

    EMBO J 1999, 18(17):4689-4699. PubMed Abstract | Publisher Full Text | PubMed Central Full Text OpenURL

  6. Ülker B, Somssich I: WRKY transcription factors: from DNA binding towards biological function.

    Curr Opin Plant Biol 2004, 7(5):491-498. PubMed Abstract | Publisher Full Text OpenURL

  7. Ishiguro S, Nakamura K: Characterization of a cDNA encoding a novel DNA-binding protein, SPF1, that recognizes SP8 sequences in the 5' upstream regions of genes coding for sporamin and beta-amylase from sweet potato.

    Mol Gen Genet 1994, 244(6):563-571. PubMed Abstract | Publisher Full Text OpenURL

  8. Rushton P, Macdonald H, Huttly A, Lazarus C, Hooley R: Members of a new family of DNA-binding proteins bind to a conserved cis-element in the promoters of alpha-Amy2 genes.

    Plant Mol Biol 1995, 29(4):691-702. PubMed Abstract | Publisher Full Text OpenURL

  9. Eulgem T, Rushton P, Robatzek S, Somssich I: The WRKY superfamily of plant transcription factors.

    Trends Plant Sci 2000, 5(5):199-206. PubMed Abstract | Publisher Full Text OpenURL

  10. Hara K, Yagi M, Kusano T, Sano H: Rapid systemic accumulation of transcripts encoding a tobacco WRKY transcription factor upon wounding.

    Mol Gen Genet 2000, 263:30-37. PubMed Abstract | Publisher Full Text OpenURL

  11. Hinderhofer K, Zentgraf U: Identification of a transcription factor specifically expressed at the onset of leaf senescence.

    Planta 2001, 213(3):469-473. PubMed Abstract | Publisher Full Text OpenURL

  12. Johnson C, Kolevski B, Smyth D: TRANSPARENT TESTA GLABRA2, a trichome and seed coat development gene of Arabidopsis, encodes a WRKY transcription factor.

    Plant Cell 2002, 14(6):1359-1375. PubMed Abstract | Publisher Full Text | PubMed Central Full Text OpenURL

  13. Pnueli L, Hallak-Herr E, Rozenberg M, Cohen M, Goloubinoff P, Kaplan A, Mittler R: Molecular and biochemical mechanisms associated with dormancy and drought tolerance in the desert legume Retama raetam.

    Plant J 2002, 31(3):319-330. PubMed Abstract | Publisher Full Text OpenURL

  14. Izaguirre M, Scopel A, Baldwin I, Ballare C: Convergent responses to stress. Solar ultraviolet-B radiation and Manduca sexta herbivory elicit overlapping transcriptional responses in field-grown plants of Nicotiana longiflora.

    Plant Physiol 2003, 132(4):1755-1767. PubMed Abstract | Publisher Full Text | PubMed Central Full Text OpenURL

  15. Sun C, Palmqvist S, Olsson H, Boren M, Ahlandsberg S, Jansson C: A novel WRKY transcription factor, SUSIBA2, participates in sugar signaling in barley by binding to the sugar-responsive elements of the iso1 promoter.

    Plant Cell 2003, 15(9):2076-2092. PubMed Abstract | Publisher Full Text | PubMed Central Full Text OpenURL

  16. Xu Y, Wang J, Wang S, Wang J, Chen X: Characterization of GaWRKY1, a cotton transcription factor that regulates the sesquiterpene synthase gene (+)-delta-cadinene synthase-A.

    Plant Physiol 2004, 135:507-515. PubMed Abstract | Publisher Full Text | PubMed Central Full Text OpenURL

  17. Zhang Z, Xie Z, Zou X, Casaretto J, Ho T, Shen Q: A rice WRKY gene encodes a transcriptional repressor of the gibberellin signaling pathway in aleurone cells.

    Plant Physiol 2004, 134(4):1500-1513. PubMed Abstract | Publisher Full Text | PubMed Central Full Text OpenURL

  18. Xie Z, Zhang Z, Zou X, Huang J, Ruas P, Thompson D, Shen Q: Annotations and functional analyses of the rice WRKY gene superfamily reveal positive and negative regulators of abscisic acid signaling in aleurone cells.

    Plant Physiol 2005, 137:176-189. PubMed Abstract | Publisher Full Text | PubMed Central Full Text OpenURL

  19. Marè C, Mazzucotelli E, Crosatti C, Francia E, Stanca A, Cattivelli L: Hv-WRKY38: a new transcription factor involved in cold- and drought-response in barley.

    Plant Mol Biol 2004, 55(3):399-416. PubMed Abstract | Publisher Full Text OpenURL

  20. Rushton P, Torres J, Parniske M, Wernert P, Hahlbrock K, Somssich I: Interaction of elicitor-induced DNA-binding proteins with elicitor response elements in the promoters of parsley PR1 genes.

    EMBO J 1996, 15(20):5690-700. PubMed Abstract | PubMed Central Full Text OpenURL

  21. Kim C, Lee S, Park H, Bae C, Cheong Y, Choi Y, Han C, Lee S, Lim C, Cho M: Identification of rice blast fungal elicitor-responsive genes by differential display analysis.

    Mol Plant Microbe Interact 2000, 13(4):470-474. PubMed Abstract | Publisher Full Text OpenURL

  22. Kalde M, Barth M, Somssich I, Lippok B: Members of the Arabidopsis WRKY group III transcription factors are part of different plant defense signaling pathways.

    Mol Plant Microbe Interact 2003, 16(4):295-305. PubMed Abstract | Publisher Full Text OpenURL

  23. Ryu H, Han M, Lee S, Cho J, Ryoo N, Heu S, Lee Y, Bhoo S, Wang G, Hahn T, Jeon J: A comprehensive expression analysis of the WRKY gene superfamily in rice plants during defense response.

    Plant Cell 2006, 25(8):836-847. Publisher Full Text OpenURL

  24. Eulgem T, Somssich I: Networks of WRKY transcription factors in defense signaling.

    Curr Opin Plant Biol 2007, 10:366-371. PubMed Abstract | Publisher Full Text OpenURL

  25. Pandey SP, Somssich IE: The role of WRKY transcription factors in plant immunity.

    Plant Physiol 2009, 150(4):1648-55. PubMed Abstract | Publisher Full Text OpenURL

  26. Luo M, Dennis E, Berger F, Peacock W, Chaudhury A: MINISEED3 (MINI3), a WRKY family gene, and HAIKU2 (IKU2), a leucine-rich repeat (LRR) KINASE gene, are regulators of seed size in Arabidopsis.

    Proc Natl Acad Sci USA 2005, 102(48):17531-17536. PubMed Abstract | Publisher Full Text | PubMed Central Full Text OpenURL

  27. Alonso J, Stepanova A, Leisse T, Kim C, Chen H, Shinn P, Stevenson D, Zimmerman J, Barajas P, Cheuk R, Gadrinab C, Heller C, Jeske A, Koesema E, Meyers C, Parker H, Prednis L, Ansari Y, Choy N, Deen H, Geralt M, Hazari N, Hom E, Karnes M, Mulholland C, Ndubaku R, Schmidt I, Guzman P, Aguilar-Henonin L, Schmid M, Weigel D, Carter D, Marchand T, Risseeuw E, Brogden D, Zeko A, Crosby W, Berry C, Ecker J: Genome-wide insertional mutagenesis of Arabidopsis thaliana.

    Science 2003, 301(5633):653-657. PubMed Abstract | Publisher Full Text OpenURL

  28. Xu X, Chen C, Fan B, Chen Z: Physical and functional interactions between pathogen-induced Arabidopsis WRKY18, WRKY40, and WRKY60 transcription factors.

    Plant Cell 2006, 18(5):1310-1326. PubMed Abstract | Publisher Full Text | PubMed Central Full Text OpenURL

  29. Wang D, Amornsiripanitch N, Dong X: A genomic approach to identify regulatory nodes in the transcriptional network of systemic acquired resistance in plants.

    PLoS Pathog 2006, 2(11):1042-1050. Publisher Full Text OpenURL

  30. Deslandes L, Olivier J, Theulieres F, Hirsch J, Feng D, Bittner-Eddy P, Beynon J, Marco Y: Resistance to Ralstonia solanacearum in Arabidopsis thaliana is conferred by the recessive RRS1-R gene, a member of a novel family of resistance genes.

    Proc Natl Acad Sci USA 2002, 99:2404-2409. PubMed Abstract | Publisher Full Text | PubMed Central Full Text OpenURL

  31. Li J, Brader G, Palva E: The WRKY70 transcription factor: a node of convergence for jasmonate-mediated and salicylate-mediated signals in plant defense.

    Plant Cell 2004, 16(2):319-31. PubMed Abstract | Publisher Full Text | PubMed Central Full Text OpenURL

  32. Knoth C, Ringler J, Dangl J, Eulgem T: Arabidopsis WRKY70 is required for full RPP4-mediated disease resistance and basal defense against Hyaloperonospora parasitica.

    Mol Plant Microbe Interact 2007, 20:120-128. PubMed Abstract | Publisher Full Text OpenURL

  33. Zheng Z, Qamar S, Chen Z, Mengiste T: Arabidopsis WRKY33 transcription factor is required for resistance to necrotrophic fungal pathogens.

    Plant J 2006, 48:592-605. PubMed Abstract | Publisher Full Text OpenURL

  34. Zhang Y, Wang L: The WRKY transcription factor superfamily: its origin in eukaryotes and expansion in plants.

    BMC Evol Biol 2005, 5:1-12. PubMed Abstract | BioMed Central Full Text | PubMed Central Full Text OpenURL

  35. Wu K, Guo Z, Wang H, Li J: The WRKY family of transcription factors in rice and Arabidopsis and their origins.

    DNA Res 2005, 12:9-26. PubMed Abstract | Publisher Full Text OpenURL

  36. Rizhsky L, Liang H, Mittler R: The Combined Effect of Drought Stress and Heat Shock on Gene Expression in Tobacco.

    Plant Physiology 2002, 130:1143-1151. PubMed Abstract | Publisher Full Text | PubMed Central Full Text OpenURL

  37. Mangelsen E, Kilian J, Berendzen K, Kolukisaoglu U, Harter K, Jansson C, Wanke D: Phylogenetic and comparative gene expression analysis of barley (Hordeum vulgare) WRKY transcription factor family reveals putatively retained functions between monocots and dicots.

    BMC Genomics 2008, 9:194. PubMed Abstract | BioMed Central Full Text | PubMed Central Full Text OpenURL

  38. Ribot C, Hirsch J, Balzergue S, Tharreau D, Nottéghem JL, Lebrun MH, Morel JB: Susceptibility of rice to the blast fungus, Magnaporthe grisea.

    Journal of Plant Physiology 2007, 165:114-124. PubMed Abstract | Publisher Full Text OpenURL

  39. Faivre-Rampant O, Thomas J, Allegre M, Morel J, Tharreau D, Notteghem J, Lebrun M, Schaffrath U, Piffanelli P: Characterization of the model system rice-Magnaporthe for the study of non host resistance in cereals.

    New Phytologist 2008, 180:592-605. Publisher Full Text OpenURL

  40. Ramamoorthy R, Jiang S, Kumar N, Venkatesh P, Ramachandran S: A comprehensive transcriptional profiling of the WRKY gene family in rice under various abiotic and phytohormone treatments.

    Plant Cell 2008, 49:865-879. OpenURL

  41. Toufighi K, Brady S, Austin R, Ly E, Provart N: The Botany Array Resource: e-Northerns, Expression Angling, and promoter analyses.

    Plant J 2005, 43:153-163. PubMed Abstract | Publisher Full Text OpenURL

  42. Menges M, Dóczi R, Ökrész L, Morandini P, Mizzi L, Soloviev M, Murray JAH, Bögre L: Comprehensive gene expression atlas for the Arabidopsis MAP kinase signalling pathways.

    New Phytologist 2008, 179:643-662. PubMed Abstract | Publisher Full Text OpenURL

  43. De Folter S, Immink RG, Kieffer M, Parenicová L, Henz SR, Weigel D, Busscher M, Kooiker M, Colombo L, Kater MM, Davies B, Angenent GC: Comprehensive interaction map of the Arabidopsis MADS-BOX transcription factors.

    Plant Cell 2005, 17:1424-1433. PubMed Abstract | Publisher Full Text | PubMed Central Full Text OpenURL

  44. Immink RG, Tonaco IA, de Folter S, Shchennikova A, van Dijk AD, Busscher-Lange J, Borst JW, Angenent GC: SEPALLATA3: the 'glue' for MADS-BOX transcription factor complex formation.

    Genome Biol 2009, 10:R24. PubMed Abstract | BioMed Central Full Text | PubMed Central Full Text OpenURL

  45. Verelst W, Twell D, de Folter S, Immink R, Saedler H, Münster T: MADS-complexes regulate transcriptome dynamics during pollen maturation.

    Genome Biol 2007, 8:R249. PubMed Abstract | BioMed Central Full Text | PubMed Central Full Text OpenURL

  46. Jiang D, Wang Y, Wang Y, He Y: Repression of FLOWERING LOCUS C and FLOWERING LOCUS T by the Arabidopsis Polycomb Repressive Complex 2 Components.

    PLoS ONE 2008, 3(10):e3404. PubMed Abstract | Publisher Full Text | PubMed Central Full Text OpenURL

  47. Andreasson E, Jenkins T, Brodersen P, Thorgrimsen S, Petersen NH, Zhu S, Qiu JL, Micheelsen P, Rocher A, Petersen M, Newman MA, Bjorn Nielsen H, Hirt H, Somssich I, Mattsson O, Mundy J: The MAP kinase substrate MKS1 is a regulator of plant defense responses.

    EMBO J 2005, 24:2579-2589. PubMed Abstract | Publisher Full Text | PubMed Central Full Text OpenURL

  48. Journot-Catalino N, Somssich IE, Roby D, Kroj T: The transcription factors WRKY11 and WRKY17 act as negative regulators of basal resistance in Arabidopsis thaliana.

    Plant Cell 2006, 18(11):3289-3302. PubMed Abstract | Publisher Full Text | PubMed Central Full Text OpenURL

  49. Lai Z, Vinod K, Zheng Z, Fan B, Chen Z: Roles of Arabidopsis WRKY3 and WRKY4 transcription factors in plant responses to pathogens.

    BMC Plant Biol 2008, 8:68. PubMed Abstract | BioMed Central Full Text | PubMed Central Full Text OpenURL

  50. Conte M, Gaillard S, Lanau N, Rouard M, Perin C: GreenPhylDB: a database for plant comparative genomics.

    Nucleic Acids Res 2008, 36:991-998. Publisher Full Text OpenURL

  51. Zhang J, Peng Y, Guo Z: Constitutive expression of pathogen-inducible OsWRKY31 enhances disease resistance and affects root growth and auxin response in transgenic rice plants.

    Cell Res 2008, 18:508. PubMed Abstract | Publisher Full Text OpenURL

  52. Liu X, Bai X, Wang X, Chu C: OsWRKY71, a rice transcription factor, is involved in rice defense response.

    J Plant Physiol 2007, 164:967-979. OpenURL

  53. Chujo T, Takai R, Akimoto-Tomiyama C, Ando S, Minami E, Nagamura Y, Kaku H, Shibuya N, Yasuda M, Nakashita H, Umemura K, Okada A, Okada K, Nojiri H, Yamane H: Involvement of the elicitor-induced gene OsWRKY53 in the expression of defense-related genes in rice.

    Biochim Biophys Acta 2007, 1769:497-505. PubMed Abstract | Publisher Full Text OpenURL

  54. Shimono M, Sugano S, Nakayama A, Jiang C-J, Ono K, Toki S, Takatsuji H: Rice WRKY45 plays a crucial role in benzothiadiazole-inducible blast resistance.

    Plant Cell 2007, 19:2064-2076. PubMed Abstract | Publisher Full Text | PubMed Central Full Text OpenURL

  55. Guimil S, Chang H, Zhu T, Sesma A, Osbourn A, Roux C, Ioannidis V, Oakeley E, Docquier M, Descombes P, Briggs S, Paszkowski U: Comparative transcriptomics of rice reveals an ancient pattern of response to microbial colonization.

    Proc Natl Acad Sci USA 2005, 102(22):8066-8070. PubMed Abstract | Publisher Full Text | PubMed Central Full Text OpenURL

  56. Cheong YH, Chang HS, Gupta R, Wang X, Zhu T, Luan S: Transcriptional profiling reveals novel interactions between wounding, pathogen, abiotic stress, and hormonal responses in Arabidopsis.

    Plant Physiol 2002, 129:661-677. PubMed Abstract | Publisher Full Text | PubMed Central Full Text OpenURL

  57. Mahalingam R, Gomez-Buitrago AM, Eckardt N, Shah N, Guevara-Garcia A, Day P, Raina R, Fedoroff NV: Characterizing the stress/defense transcriptome of Arabidopsis.

    Genome Biol 2003, 4:R20. PubMed Abstract | BioMed Central Full Text | PubMed Central Full Text OpenURL

  58. Chen W, Provart NJ, Glazebrook J, Katagiri F, Chang HS, Eulgem T, Mauch F, Luan S, Zou G, Whitham SA, Budworth PR, Tao Y, Xie Z, Chen X, Lam S, Kreps JA, Harper JF, Si-Ammour A, Mauch-Mani B, Heinlein M, Kobayashi K, Hohn T, Dangl JL, Wang X, Zhu T: Expression profile matrix of Arabidopsis transcription factor genes suggests their putative functions in response to environmental stresses.

    Plant Cell 2002, 14:559-574. PubMed Abstract | Publisher Full Text | PubMed Central Full Text OpenURL

  59. Jia Y, Valent B, Lee FN: Determination of host responses to Magnaporthe grisea on detached rice leaves using a spot inoculation method.

    Plant Dis 2003, 87:129-133. Publisher Full Text OpenURL

  60. Brandt S, Kloska S, Altmann T, Kehr J: Using array hybridization to monitor gene expression at the single cell level.

    J Exp Bot 2002, 53:2315-2323. PubMed Abstract | Publisher Full Text OpenURL

  61. Colombo L, Franken J, Krol AR, Wittich PE, Dons HJ, Angenent GC: Downregulation of ovule-specific MADS-BOX genes from petunia results in maternally controlled defects in seed development.

    Plant Cell 1997, 9:703-715. PubMed Abstract | Publisher Full Text | PubMed Central Full Text OpenURL

  62. Ohtsu K, Smith MB, Emrich SJ, Borsuk LA, Zhou R, Chen T, Zhang X, Timmermans MC, Beck J, Buckner B, Janick-Buckner D, Nettleton D, Scanlon MJ, Schnable PS: Global gene expression analysis of the shoot apical meristem of maize (Zea mays L.).

    Plant J 2007, 52:391-404. PubMed Abstract | Publisher Full Text | PubMed Central Full Text OpenURL

  63. Ramsay K, Jones MGK, Wang Z: Laser capture microdissection: a novel approach to microanalysis of plant-microbe interactions.

    Mol Plant Pathol 2006, 7:429-435. Publisher Full Text OpenURL

  64. Honma T, Goto K: Complexes of MADS-BOX proteins are sufficient to convert leaves into floral organs.

    Nature 2001, 409:525-529. PubMed Abstract | Publisher Full Text OpenURL

  65. Ditta G, Pinyopich A, Robles P, Pelaz S, Yanofsky MF: The SEP4 gene of Arabidopsis thaliana functions in floral organ and meristem identity.

    Curr Biol 2004, 14:1935-1940. PubMed Abstract | Publisher Full Text OpenURL

  66. Messenguy F, Dubois E: Role of MADS-BOX proteins and their cofactors in combinatorial control of gene expression and cell development.

    Gene 2003, 316:1-21. PubMed Abstract | Publisher Full Text OpenURL

  67. Edgar RC: MUSCLE: multiple sequence alignment with high accuracy and high throughput.

    Nucl Acids Res 2004, 32(5):1792-1797. PubMed Abstract | Publisher Full Text | PubMed Central Full Text OpenURL

  68. Guindon S, Gascuel O: A simple, fast, and accurate algorithm to estimate large phylogenies by maximum likelihood.

    Syst Biol 2003, 52(5):696-704. PubMed Abstract | Publisher Full Text OpenURL

  69. Letunic I, Bork P: Interactive Tree Of Life (iTOL): an online tool for phylogenetic tree display and annotation.

    Bioinformatics 2007, 23(1):127-128. PubMed Abstract | Publisher Full Text OpenURL

  70. Smyth G, Michaud J, Scott H: Use of within-array replicate spots for assessing differential expression in microarray experiments.

    Bioinformatics 2005, 21:2067-2075. PubMed Abstract | Publisher Full Text OpenURL

  71. Benjamini Y, Hochberg Y: Controlling the false discovery rate: a practical and powerful approach to multiple testing.

    Journal of the Royal Statistical Society 1995, 57:289-300. OpenURL

  72. Pfaffl M: A new mathematical model for relative quantification in real-time RT-PCR.

    Nucleic Acids Res 2001, 29:2002-2007. Publisher Full Text OpenURL