Table 1

Group and sub-group of consensus specific conserved amino acids motifs
Motifa E-value Multilevel consensous sequenceb
1 3.3e-3898 CPRCDST[ND]TKFCY[YF]NNY[SN]LSQPR[HY]FC[KR][AT]CRRYWT[KRA]GG[AS]LRNVPVGGG[CR]R[KR]
3 1.0e-081 [GAD][DA][GAS][GLA][IF]KLFG[KR][VT]I[PT][LVP][PQ]
4 1.9e-054 [ALP][PRL][VAFL][LM][QHK][AG]NP[AV]A[LF][ST]RS[QV][ST]FQE
5 2.0e-040 GA[FL]SAMELLRSTGCY[MV]PL[PQ]Q
6 7.7e-148 [PS][MG]SM[ST]ERAR[LM]A[RK][VI]P[QL]PEPGL[KN]
7 2.8e-043 [DK][PV][AP][AT][AADGSTIDLA[ML]LY[SA]KFL[SN][HN]Q
8 5.4e-034 LGEL[NA]F[AGSV][MV]DQSC[FY]D[SA]LGLP[TAM][DP]
10 6.5e-027 [HP]GP[VL]RPDM[VL]LEGMVGN
11 7.1e-027 R[LM]LFPFEDLKP
12 9.0e-026 [HG][EG][GA]A[HQ]DLNLAFPHH[HG]
13 3.3e-024 [WM][PV][NPA][GT]AW[NS][ALS]PW[PI]
14 2.7e-011 [PQ][QP]FA[GT]VDLRRPKGY
15 3.1e-012 [EDQ][FY][MAPT]AFPSLESSS[VIM][CG][NG]
28 7.2e-209 [GEKR][DE][DE][KN][GER][EN][GKN][KS][LV]W[VI]PKT[LI]RID[DN][PA][DA]E[AV]A[KR]SSI[WR][SAT][TL][LFI]GI[KE][PG][DG][DK][RKPV]G[IM] [FD][KR][SPG][FR][QG][SC][KG]
29 2.9e-074 [KQ]T[EAQ][DGNS][DE][EGT][SA][SDN][QE][DEK][KE][VK]LKKPDKILP
30 1.1e-030 S[PSI][VST][CS][ST]M[SN][SGN][SC][FP][TV]LGKH[PS]R[DE][GS]D[]
31 6.2e-036 MDAA[HQ]W[HP]QGLGLVKPMEEM[LI]M
32 2.8e-027 [NM][G][LM]EQWR[AL][AQ]QMQSFPFFHAMDHQ
33 7.3e-026 [AG]HHHHGSSA
34 2.1e-030 R[RK][AL]RPQ[KH][ED][KQ][AP][LI]
35 6.2e-027 [STI][TFQ][AFNPT][NSTY][PAS][FDV][ADP][AGPT][DLP][VLS][PQ]PPAP[IM]FADQA[AT][AT][LF]ASLF[AG][PT]P[PR]P[PA][PF][LST][PFQ][VAS] [FAL][SNPQ][FAR]
36 2.6e-025 MQ[ED]F[QH][SP][IV]PGL[AT]GRLFGGAA[AD][AR][ADP][AID][RGIV][RAL]
37 1.2e-016 PMH[FI]CMDSDWLKG[IM]V
38 1.7e-036 LSSWCSIVPSLSTWEEPKYDSLDSFPDD[AT][ML]SLH[DE][CGH][GIM][IL]
39 8.9e-015 RVADHQHDDGRRAVRRGDVRALRRRRLPAHGPFVGTVVAAVTVVVVRCNL
40 2.8e-014 EEWMQEQDGLLCMRGRRCGRRGGCLPRPRDWFAALLAADPAAAAVTRDQ
41 2.3e-011 TVADM[AT]PF[MT]SLDAGIFELGD[AV][PS]PA[AD]YWN[AG]GSCWTDV[PQ]DP[NS]VYL

a Numbers correspond to the motifs described in Figure 4. b Consensus amino acid sequences obtained from the analysis of the 81 Brachypodium, rice and barley Dof genes with the MEME software. Motifs from 1 to 15 are equivalent to the motifs 1 to 15 described in Additional files 2 and 3. Motif 1 corresponds to the DOF DNA-binding domain.

Hernando-Amado et al.

Hernando-Amado et al. BMC Plant Biology 2012 12:202   doi:10.1186/1471-2229-12-202

Open Data