Table 5

Repetitive motifs containing transmembrane and extracellular proteins

ID

BLASTX

Pfam/Interpro

L

Repeat

ESTs


cn349

Multicystatin

No significant hit

EC

2X

DKIPKSVLEFGINKLELSNVFAHKDFSKIENAQMKVVSGYIYKFTLVYQFSEQEHKFEIQVWSKADQTLELISMKEIT

7

cn66

Unknown protein

EGF-like domain

EC

4X

YVNNGSCSSNSTLFNFTSKNCEKSCG

22

cn65

Insect antifreeze protein

EGF-like domain

EC

5X

LFNFTSKNCEKSCGESGY

10

cn131

Protein disulfide-isomerase domain containing protein

Protein disulphide isomerase family

EC

3X

EEKEEK

9

cn85

Predicted protein

Ricin-type beta-trefoil lectin domain

EC

4X

VLDVYG

8

cn81

Chitinase

Glycoside hydrolase, family 18 domain, chitinase active site

EC

2X

YARGYELCKTPGDKLDKIFYAFLNPTTG

CiTo 53E07

Membrane associated protein

No significant hit

TM

9X

FSFLLFFFFFSFWS

1

CiTo 12F11

No significant hit

EGF-like domain, Metridin-like ShK toxin

EC

3X

AETGST

1

CiTo 13H10

Tenascin

EGF domain

TM

3X

PNNCSG

CiTo 26C11

No significant hit

No significant hit

TM

3X

EKCRCL

1

CiTo 2H11

No significant hit

No significant hit

EC

3X

AKTAAE

1

CiTo 6G09

Cation diffusion facilitator family transporter

Cation efflux protein

family

TM

3X

GHGHSH

1


L, Localization; TM, transmembrane domain; EC, extracellular

Lokanathan et al. BMC Genomics 2010 11:76   doi:10.1186/1471-2164-11-76

Open Data