Table 3

Amino acid sequence of the FTZ-F1 box of various NR5A group members.

Gene

FTZ-F1 box


Dappu-FTZ-F1

AVRADRMRGGRNKFGPMYKRDRARKLQVMR

DmFTZ-F1

AVRADRMRGGRNKFGPMYKRDRARKLQVMR

HsSF1

AVRADRMRGGRNKFGFMYKRDRALKQQKKA

HsLRH1

AVRADRMRGGRNKFGFMYKRDRALKQQKKA

CeNHR25

AVRADRMRGGRNKFGSFYKKDRAHRMQRNA


Bolded amino acids indicate differences from Dappu-FTZ-F1. Amino acid sequences were derived from [82].

Thomson et al. BMC Genomics 2009 10:500   doi:10.1186/1471-2164-10-500

Open Data