Table 3

Group and sub-group specific conserved motifs

Motifa

Multilevel consensus sequenceb


1

CPRCDSTNTKFCYYNNYSLSQPRHFCKACRRYWTKGGALRNVPVGGGCRKc

2

KGEGCLWVPKTLRIDDPDEAAKSSIWTTLGIK

3

DDPGIKLFGKTIPF

4

KALKKPDKILP

5

LQANPAALSRSQNFQE

6

PMDRLAFGDESFEQDYYDVGSDDLIVNPLIGGS

7

KRAKIDQPSVAQMVSVEIQPGNHQPFFNVQENNDFVGSF

8

MDNLNVFANEDNQVNDVKPPP

9

SPTLGKHSRDE

10

YHMNPVDQFKWNQSFNNAMNMNYNN

11

RVLWGFPWQM

12

ERKARPQKDQ

13

IDLALAYAKFLKHH

14

ATALKFASDSPLCESMASVLDIGEK

15

RLLFPFEDLKPLVS

16

HGGFRHDF

    PMKRLRC
YSDGQSCd

17

MVFSSVPAYLD

18

FYPVPAYWGC

19

KNPKLLHEGAQDLNLAFPHH

20

GHVDQIDSGREIW

21

VAAVGNHFGSLSEIHG

22

MMDSNSVLYSSLGFPTMPDYK

23

CFPGVPWPYTW

24

FGHRFHGPVRPDMILEGM

25

INVKPMEEI

26

IESLSCFNQDLHQKLQQQR

27

YWSGMI

28

WTDLAMNRAEK

29

LEQWRLPQIQQFPFFHAMDAM

30

WGCFSGWPNGAWNAPWI

31

EAGRRPAPQFAGVDLRRPKGY

32

NKGWPSSDHYLHITSEDCDN

33

HAAPIPATWQFEGLE

34

MELLRSTGCYM

35

MHPCHLEK

36

PIEFLGLPGNLQFW

37

DEEAKYDPFDSFPDDALSLHDCI


a Numbers correspond to the motifs described in Figure 3. b Sequences obtained from the analysis of the 66 rice and Arabidopsis Dof complete proteins with the MEME system. c Dof consensus sequence (in italics). d Predicted nuclear localization signal, according to Park et al [50] (underlined).

Lijavetzky et al. BMC Evolutionary Biology 2003 3:17   doi:10.1186/1471-2148-3-17

Open Data