Table 2

Peptide support for intronized retrogenes
Gene name Peptide match Peptide database referencea Location in protein seq BLASTP hitsb
HSP90B2P NLNFVKGVVDSGGLSLNVSCETLQQHK PRIDE: 8670 86 Self (4e-19, 100 %)
IEKAMVSQCLTESLCALVASQYGWSGNMER PRIDE: 8670 270 Self (4e-24, 100 %)
AMVSQCLTESLCALVASQYGWSGNMER PRIDE: 8671; 8668 273 Self (7e-21, 100 %)
MAETIQEVEDEYKAFCK PRIDE: 8672 1 Self (9e-11, 100 %)
CVFITDDFRDTMPK PRIDE: 8669 72 Self (7e-08, 100 %)
HSP90AA4P HNNDEQYAWESSLR PeptideAtlas: PAp00393519 93 Self (1e-07, 100 %)
ADLINNLGTITK PeptideAtlas: PAp01587648 20 Self (8e-04, 100 %)
DQVANSTIVQR PeptideAtlas: PAp00565957 207 Self (0.005, 100 %)
HSP90AA5P IKEIVKKHSQFIGYPITLFVEKKR PeptideAtlas: PAp00040955; PAp00423980 33 Self (2e-17, 100 %)
HGLEVIYMIELIDKYCVQQLK PeptideAtlas: PAp00040711 199 Self (2e-15, 100 %)

‘a’, Database name and experiment numbers or identifiers. ‘b’, BLASTP search against the GenBank non-redundant protein database (e-value and maximum identity of the match are shown in parentheses [32,33]).

Kang et al.

Kang et al. BMC Evolutionary Biology 2012 12:128   doi:10.1186/1471-2148-12-128

Open Data