Table 2

Prediction of the chloroplast targeting signals in candidate TM-type tRNase ZSs from flowering plants

Protein name

Form

Chl

Chloroplast targeting signal


AcoTrz1

AcoTrzS1

-

AcoTrz2

AcoTrzS2

C

MKISLGISTSPILLPFSKPTLKIPHNRVCIP (31)

AlyTrz1

AlyTrzS1

-

AlyTrz2

AlyTrzS2

C

MQLSSFPISPSKIFPFTKYHAPPVIIHQLAAQIQSHRSNFVSPVKVSGYFSSISRAIEEEEEYRKAR (67)

AthTrz1

AthTrzS1

-

AthTrz2

AthTrzS2

C

MQLSSSFPISPPKIFPSTKHHKPPVITHQLAAQIQSNRRHFVSPVKVSGYFSSISRAIEEEEEYRKAR (68)

BdiTrz1

BdiTrzS1

-

BdiTrz2

BdiTrzS2

C

MATISLFSLPPLRLTRGLLSPSSGPASRFQTL (32)

CpaTrz1

CpaTrzS1

-

CpaTrz2

CpaTrzS2

C

MLTSVPILPSKLQSVFPFGHHHYHSISHKPTPIHQFSFLV (40)

CclTrz1

CclTrzS1

-

CclTrz2

CclTrzS2

C

MQLSLPTSPSKLPTIFPFHPSSIPKTPQSPHHLSLQSHVGPLNALKSAGFLSSISRAIDEEEEYRKAR (68)

CsiTrz1

CsiTrz S1

-

CsiTrz2

CsiTrz S2

C

MQLSLPTSPSKLPTIFPFHPSSIPKTPQSPHHLSLQSHVGPLNALKSAGFLSSISRAIDEEEEYRKAR (68)

CsaTrz1

CsaTrzS1

-

CsaTrz2

CsaTrzS2

C

MQISIPISPLRPPQVFPFHQPLLHTPKPPGVALQSHLNPVNSFRDSGLLSTIGVE (55)

EgrTrz1

EgrTrzS1

-

EgrTrz2

EgrTrzS2

C

MRISIPISPSKSPQIFPFHHHHRRRHQIPDLRRRPPALSLPASAVNPLKSSGYLSTIHR (59)

GmaTrz1

GmaTrzS1

-

GmaTrz2

GmaTrzS2

C

MQISLSDLAFKTPQLFPIHHPIFPPKPPLNHQVST (35)

MesTrz1

MesTrzS1

-

MesTrz2

MesTrzS2

C

MQTSFPVSPSKIPSIFPFNHPILHNPTAPTNHHQLPLQTYLKRPINSTSLKSSGFLSAIGRAIEEEEEYKKAR (73)

MtrTrz1

MtrTrzS1

-

MtrTrz2

MtrTrzS2

C

MQIPLTNPTFKPPQIFPFHHTIPSPKQQLSFPT (33)

MguTrz1

MguTrzS1

-

MguTrz2

MguTrzS2

C

MITLNPTTSNLLNLHPFHPTPATHKHHLPPQTRRSVIACVSDAVV (45)

OsaTrz1

OsaTrzS1

C

MANSGKSSPAATSTTAPPPGRPKAKAPPLTVEGYPVEGISIGGQETCVIFPT (52)

OsaTrz2

OsaTrzS2

C

MAATSLLSLPSLRLTHRLLVPASSSAPASRSQFQTL (36)

PtrTrz1

PtrTrzS1

-

PtrTrz2

PtrTrzS2

C

MQISIPL (7)

PpeTrz1

PpeTrzS1

-

PpeTrz2

PpeTrzS2

C

MQIFLTISPCKAPLILPFHPPISKTPKTQRTSLKTLSKPYRLARSQVLRKGV (52)

RcoTrz1

RcoTrzS1

-

RcoTrz2

RcoTrzS2

C

MQTSLPISHSKFPSIFPFNHPISHKPTTTR (30)

SitTrz1

SitTrzS1

-

SitTrz2

SitTrzS2

C

MATASLFSPPSLRLLSRTTARLSRFQTLAARKPP (34)

SitTrz3

SitTrzS3

-

SitTrz4

SitTrzS4

-

SbiTrz1

SbiTrzS1

-

SbiTrz2

SbiTrzS2

C

MATASLFSLPSLRALSRTSARCSRFQTLAARKPVESSSSTATS (43)

SbiTrz3

SbiTrzS3

-

VviTrz1

VviTrzS1

-

VviTrz2

VviTrzS2

C

MQISLPFSTSKVPYLSPLPNPTPQPPLTIPKPHPKSYIT (39)

ZmaTrz1

ZmaTrzS1

-

ZmaTrz2

ZmaTrzS2

C

MVTASLFSLPSLRVLSRTSAHGPRFQILAARKPVESSTATSGSRRGGSKGAGLLSVLDR (59)


Identification of the putative chloroplast targeting signals was made by using ChloroP http://www.cbs.dtu.dk/services/ChloroP/ webcite. Chl stands for the chloroplast. C indicates chloroplast localization. "-", the localization could not be predicted. The numbers refer to amino acid positions starting from the N-terminus.

Fan et al. BMC Evolutionary Biology 2011 11:219   doi:10.1186/1471-2148-11-219

Open Data