Characterization of the tandem CWCH2 sequence motif: a hallmark of inter-zinc finger interactions
-
* Corresponding author: Jun Aruga jaruga@brain.riken.jp
1 Laboratory for Behavioral and Developmental Disorders, RIKEN Brain Science Institute, Wako-shi, Saitama 351-0198, Japan
2 Saitama University Brain Science Institute, Saitama-shi, Saitama 338-8570, Japan
BMC Evolutionary Biology 2010, 10:53 doi:10.1186/1471-2148-10-53
The electronic version of this article is the complete one and can be found online at: http://www.biomedcentral.com/1471-2148/10/53
| Received: | 3 September 2009 |
| Accepted: | 19 February 2010 |
| Published: | 19 February 2010 |
© 2010 Hatayama and Aruga; licensee BioMed Central Ltd.
This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
Abstract
Background
The C2H2 zinc finger (ZF) domain is widely conserved among eukaryotic proteins. In Zic/Gli/Zap1 C2H2 ZF proteins, the two N-terminal ZFs form a single structural unit by sharing a hydrophobic core. This structural unit defines a new motif comprised of two tryptophan side chains at the center of the hydrophobic core. Because each tryptophan residue is located between the two cysteine residues of the C2H2 motif, we have named this structure the tandem CWCH2 (tCWCH2) motif.
Results
Here, we characterized 587 tCWCH2-containing genes using data derived from public databases. We categorized genes into 11 classes including Zic/Gli/Glis, Arid2/Rsc9, PacC, Mizf, Aebp2, Zap1/ZafA, Fungl, Zfp106, Twincl, Clr1, and Fungl-4ZF, based on sequence similarity, domain organization, and functional similarities. tCWCH2 motifs are mostly found in organisms belonging to the Opisthokonta (metazoa, fungi, and choanoflagellates) and Amoebozoa (amoeba, Dictyostelium discoideum). By comparison, the C2H2 ZF motif is distributed widely among the eukaryotes. The structure and organization of the tCWCH2 motif, its phylogenetic distribution, and molecular phylogenetic analysis suggest that prototypical tCWCH2 genes existed in the Opisthokonta ancestor. Within-group or between-group comparisons of the tCWCH2 amino acid sequence identified three additional sequence features (site-specific amino acid frequencies, longer linker sequence between two C2H2 ZFs, and frequent extra-sequences within C2H2 ZF motifs).
Conclusion
These features suggest that the tCWCH2 motif is a specialized motif involved in inter-zinc finger interactions.
Background
Zinc finger (ZF) domains (ZFDs) are found in a large number of eukaryotic proteins [1-3]. A single ZF normally forms a globular structure that is stabilized by binding a zinc ion. Many classes of ZFs have been described in public databases (Pfam, http://pfam.sanger.ac.uk/ webcite; Prosite, http://au.expasy.org/prosite/ webcite; Interpro, http://www.ebi.ac.uk/interpro/ webcite; SMART, http://smart.embl-heidelberg.de/ webcite), with Cys-Xn-Cys-Xn-His-Xn-His (C2H2) being one of the most common. Most C2H2 ZF proteins contain tandem arrays of the C2H2 motif, which are located at specific intervals to form a functional domain. ZFDs were originally identified as the DNA-binding domain of transcription factor IIIA (TFIIIa) and other transcription factors, but accumulating evidence suggests that ZFDs also bind RNA and proteins [4-6]. Since ZFDs are essential for many biological processes, their structure-function relationships have been well studied. For the DNA-binding ZFs, the structures of ZFD-DNA complexes have been elucidated for GLI [7], TFIIIA [8], zif268 [9], YY1 [10], and WT1 [11]. These findings have enabled the development of synthetic ZF proteins as versatile molecular tools [12]. Despite their important and widespread roles, the structural basis of ZFD-protein interactions is less understood than those of ZFD-DNA interactions.
The identification of the critical structural features of protein-binding ZFDs remains elusive [5] but some clues are available for a group of ZFs that mediate protein-to-protein interactions [4-6]. Previously, we studied the intra-molecular protein-to-protein interaction between two adjacent C2H2 ZFs [13]. The two N-terminal ZFs (ZF1 and ZF2) of human ZIC3, which has a ZFD composed of five ZFs (ZF1-ZF5), form a single structural unit through a common hydrophobic core. This ZF-connecting hydrophobic core is associated with two tryptophan residues, each of which is located between the zinc-binding cysteine residues in ZF1 and ZF2. Mutation of the tryptophan in ZF1 (W255G) perturbs the subcellular localization and function of the protein, and is associated with a pathological and congenital heart malformation [13,14]. The importance of these tryptophan residues is further supported by their conservation among more than 40 Zic proteins identified in a wide range of eumetazoan species [15].
Previous studies have revealed that human GLI1 (PDBID: 2GLI) and yeast Zap1 (PDBID: 1ZW8) also possess ZFs with two tryptophans in the corresponding region and that these tryptophans are located in the hydrophobic core formed by two adjacent ZFs [16]. These data raise the possibility that domains containing the consensus sequence "Cys-X-Trp-Xn-Cys-Xn-His-Xn-His-Xn-Cys-X-Trp-Xn-Cys-Xn-His-Xn-His", which we have named the tandem CWCH2 (tCWCH2) motif, are involved in the interaction between the two adjacent ZFs. Since our knowledge of the tCWCH2 motif is limited to a small group of proteins, the biological significance of the tCWCH2 structure is unclear.
In the present study, we performed a computer-based analysis of the tCWCH2 motif using sequence data derived from public databases. We classified the tCWCH2-containing sequences into gene classes and then determined their conservation status in each protein family and their phylogenic distribution. We also identified sequence features unique to tCWCH2-containing ZFDs. The significance of the tCWCH2 motif is discussed in terms of its possible structural and functional roles.
Results
Three-dimensional structure of known tCWCH2 motifs
To investigate the positions of the two key tryptophan residues in different tCWCH2 motifs, we performed a structural alignment to compare the three-dimensional (3D) structures of the tCWCH2 motifs from ZIC3 (PDBID: 2RPC), GLI1 (PDBID: 2GLI) and Zap1 (PDBID: 1ZW8) ZFDs (Figure 1A) with that of two C2H2 ZFs. Our data show that all of these C2H2 ZF motifs form globular structures composed of two anti-parallel β sheets and an α helix (ββα). The two tryptophan residues between the two zinc-chelating cysteine residues (Figure 1B) were localized onto the anti-parallel β sheet where they were juxtaposed to each other. The relative positions of the two tryptophans were similar among the three tCWCH2 structures, as was each zinc-chelating residue. The tryptophan side chains were close to the zinc-chelating histidine in the same ZF, and the hydrophobic residues in the same and the opposite ZF (within 5Å, Additional file 1). This result suggested that the tryptophans play a role in both the stabilization of their own ZFs and the formation of a hydrophobic core between the two adjacent ZFs. The conserved positioning of the tCWCH2 motif-forming residue in evolutionarily distant sources led us to investigate its phylogenetic distribution and structural features.
Additional file 1. Neighboring residues of the tryptophans in tCWCH2 3D structure. (A) Distances of the tCWCH2-forming residues from the tCWCH2 ZF1 tryptophan (left) and the tCWCH2 ZF2 tryptophan (right). Black and red letters indicate residues in the ZF1 and the ZF2 respectively. Gothic letters, zinc chelating residue; *, ϕ1 and ϕ2 in Figure 5 and 6. Note that both tryptophan residues were close to the residues in the other C2H2 ZF unit. (B) Stereo view of the ZIC3, GLI1, and Zap1 tryptophan side chain adjacent residues within 5 Å. Tryptophan residues, zinc chelating histidine, ϕ1, and ϕ2 residues are labeled. For ZIC3 and Zap1, 20 NMR models in wire model are superimposed. For GLI1, cylinder model are shown. White, carbon; red, oxygen; blue, nitrogen; yellow; sulfur.
Format: PDF Size: 1.1MB Download file
This file can be viewed with: Adobe Acrobat Reader
Figure 1. Structures of tCWCH2 sequence motifs from three different proteins. (A) Superimposition of the 3D structures of ZIC3, GLI1, and Zap1 tCWCH2 is shown
in stereo view. Backbones of the protein structures are indicated by the flat ribbon
model. The side chains of two conserved tryptophan residues in tCWCH2 are indicated
by the stick model. Red = ZIC3 (PDBID: 2RPC); Blue = GLI1 (PDBID: 2GLI); Green = Zap1 (PDBID: 1ZW8). (B) Amino acid sequence alignment of the tCWCH2 regions. Zinc-chelating cysteine
and histidine residues are shown in gray boxes and conserved tryptophan residues are
shown in white letters with black boxes. In (A) and (B), the gray lines with arrowheads
indicate the sequence between the two CWCH2 motifs (linker sequence).
Database search for tCWCH2-containing sequences
We performed a comprehensive search of tCWCH2 motif-containing genes in current databases. We performed an initial search of the non-redundant NCBI protein database with PHI-BLAST using the tCWCH2 pattern deduced from the ZIC comparison and human ZIC3 (NP_003404) as the query sequence. This search yielded a set of 709 amino acid sequences that were tentatively classified into 11 gene classes according to their annotations and the pilot phylogenetic tree analyses (see Methods, Figure 2). For the fine analysis of the tCWCH2-containing sequences, we performed TBLASTN and PBLAST searches of the non-redundant sequence collection of the NCBI database using the representative sequences of the initial 11 gene classes and 3 specific genes (two Dictyostelium genes and one Monosiga gene) as the key sequences. In order to examine the distribution of the tCWCH2 sequence motif in a phylogenetic tree of eukaryotes, TBLASTN searches were also performed on a whole-genome shotgun sequence database of 24 organisms. The sequences obtained were manually checked to remove any redundant sequences. The final tCWCH2 collection contained 587 sequences that represented the non-redundant tCWCH2-containing sequences from a wide range of organisms (Additional file 2). Because the Mizf and Zap1/ZafA family genes and one Dictyostelium gene contain two independent tCWCH2 motifs, our collection included a total of 637 independent sequence regions for tCWCH2.
Additional file 2. List of tandem CWCH2-containing genes. Gene ID of NCBI or Ensembl http://www.ensembl.org/ webcite or JGI Lottia gigantea genome http://genome.jgi-psf.org/Lotgi1/Lotgi1.home.html webcite database and organism names that we collected are listed and categorized according to gene group. The EDV29271 Trichoplax adhaerens Zic amino acid sequence was manually added from the genome database, and indicates as "EDV29271+edit". The inset in right bottom indicates the numbers of non-redundant sequences in each class.
Format: PDF Size: 63KB Download file
This file can be viewed with: Adobe Acrobat Reader
Figure 2. Domain structure and function of tCWCH2-containing proteins. The 11 gene classes are listed in descending order of the number of representative
genes in each class. A Monosiga gene and two Dictyostelium genes, which do not belong to these classes, are indicated. Gene name is indicated
at the left of each row (open box = C2H2 ZF; gray box = CWCH2; gray boxes linked with
thick lines = tCWCH2; open box with curved ends = other domains). Representative genes
and their amino acid length are indicated on the left and references are shown on
the right. Hs, Homo sapiens; Dm, Drosophila melanogaster; Sc, Saccharomyces cerevisiae; Afu, Aspergillus fumigatus; Spo, Schizosaccharomyces pombe; Ro, Rhizopus oryzae; Mb, Monosiga brevicollis; Dd, Dictyostelium discoideum.
At this point, we re-evaluated the initial sequence pattern for PHI-BLAST because it was based solely on the sequence compilation of the Zic family genes. The initial PHI-BLAST pattern recovered 90% (572/637) of the collected sequences (Additional file 3). Among the 65 non-matching sequences, 20 sequences showed deviation in the C, W, and H residues of the tCWCH2 motif and 50 sequences showed derangement of the sequence length between the two CWCH2 motifs. This mismatch appeared to be distributed randomly and suggested that optimization of the PHI-BLAST pattern was unlikely to be informative. Therefore, we optimized the lengths of the intervening sequences. PHI-BLAST searches using the original pattern "xCxWx(2,35)Cx(5,15)Hx(2,5)Hx(5,25)CxWx(1,3)Cx(5,17)Hx(2,5)Hx" with a tCWCH2 consensus sequence (see Methods) yielded 911 sequences, of which 459 sequences were included in our non-redundant tCWCH2 collection. This number corresponded to 83% of the tCWCH2 sequences in the NCBI protein database (total = 551). A looser pattern, "xCxWx(1,35)Cx(5,15)Hx(2,5)Hx(5,42)CxWx(1,6)Cx(5,31)Hx(2,5)Hx" yielded 968 sequences that contains 469 tCWCH2 sequences (85% of the total) (Additional file 3). The sequences identified by the looser pattern included Zfp407 sequences that contain a pair of CWCH2 ZFs separated by another two C2H2 ZFs. These data suggest that decreasing the stringency of the search (increasing the intervening arbitrary residue number) impairs the fidelity of the search. Therefore, we consider that the original PHI-BLAST pattern is more useful for the tCWCH2 survey.
Additional file 3. PHI-BLAST pattern validity. Percentage occurrence of the PHI-BLAST pattern in the tCWCH2 library (A). Most frequent amino acid sequence for tCWCH2 in the PHI-BLAST result. A loose search pattern increases the number of BLAST hits, and increases the percentages of recovery of library (B). The tCWCH2 sequence motif collection contains 551 sequences from the NCBI protein database and 36 sequences from the NCBI nucleotide or other databases.
Format: PDF Size: 51KB Download file
This file can be viewed with: Adobe Acrobat Reader
Classification and domain structure of tCWCH2 sequence-containing proteins
We classified the non-redundant tCWCH2-containing sequences based on the available flanking amino acid sequences of the tCWCH2 domain (Figure 2). Each gene contained one or two tCWCH2 motifs among a total of 2-9 C2H2 ZF motifs. Proteins containing only one tCWCH2 domain suggest that a single tCWCH2 constitutes the minimal ZFD component. In the ZFDs composed of both tCWCH2 and non-tCWCH2 C2H2, tCWCH2s were always placed at the N-terminal end of the clustered ZFDs.
The 587 sequences included one fungus/metazoan common gene family (Arid2/Rsc9), four metazoan gene families (Zic/Gli/Glis, Mizf, Aebp2, Zfp106), three fungus gene families (PacC, Zap1/ZafA, Clr1), two social amoeba genes (named here as DdHp), and one Monosiga gene. In addition, we identified three novel fungal gene groups (Tandem-CWCH2-protein C-terminal, Fungus-Gli-like and Fungus-Gli-like-4ZF). We have summarized the structural features of each tCWCH2 gene class together with major gene functions below and in Figure 2.
Function, structure, and classification of the gene classes containing tCWCH2
Zic/Gli/Glis
The proteins encoded by these three gene classes mediate various processes in animal development [17-23]. Their ZFD is commonly composed of five C2H2 ZFs, and can bind DNA [7,24-26].
Arid2/Rsc9
Arid2/Rsc9 genes are known to encode components of an ATP-dependent chromatin remodeling complex [27-29]. The ARID (AT-rich interaction domain) and tCWCH2 domains are conserved in Arid2 and Rsc9 (Additional file 4). Another conserved sequence motif was found in the C-terminal flanking region of the tCWCH2 motif. This sequence motif is summarized as "IxL (S/T) AxL (I/V) L (K/R) N (I/L) × (K/R)" and we named this motif the LIL domain. PHI-BLAST searches for LIL domains suggested that this domain was distributed only in the Arid2/Rsc9 proteins (data not shown).
Additional file 4. The sequence of the conserved domains of Arid2 and Rsc9. The ARID domain (A) and the ZF domain (B) are conserved in Arid2 and Rsc9. Core amino acid residues of the ARID domain are indicated by asterisks (*) in (A). The structure of the tCWCH2 motifs and flanking sequence are shown in (B). Conserved sequence [IxL (S/T) AxL (I/V) L (K/R) N (I/L) x(K/R)] are indicated by asterisks (*). Hs, Homo sapiens; Dr, Danio rerio; Bm, Brugia malayi; Dm, Drosophila melanogaster; Nc Neurospora crassa; Spo, Schizosaccharomyces pombe.
Format: PDF Size: 23KB Download file
This file can be viewed with: Adobe Acrobat Reader
PacC
PacC mediates gene expression regulation by ambient pH in filamentous fungi and yeasts [30,31]. It contains an N-terminal DNA binding domain with three ZFs. Other ZF domains, named A, B, and C, are involved in responses to pH change [32,33].
Mizf
Mizf was originally reported as a seven ZF-containing protein [34-36]. We identified two additional C2H2 ZFs in the gene sequence encoding this protein (ZF2 and ZF8 in Additional file 5). The two tCWCH2 motifs in the first four ZFs (ZF1-ZF4) were separated by longer intervening sequences (>35 aa) than most ZFs.
Additional file 5. Zinc finger domains of Mizf. We found novel ZFs in Mizf. A pseudo ZF structure was found between ZF4 and ZF5 (indicated as ZF?). Hs, Homo sapiens; Dr, Danio rerio; Ta, Trichoplax adhaerens; Ci, Ciona intestinalis; Dm, Drosophila melanogaster; Ce, Caenorhabditis elegans.
Format: PDF Size: 70KB Download file
This file can be viewed with: Adobe Acrobat Reader
Aebp2
Mammalian Aebp2 is a DNA binding transcription factor [37]. Its Drosophila homolog, jing, is required for cellular differentiation [38-42].
Zap1/ZafA
The proteins encoded by Zap1/ZafA should be grouped together because of the similarity in structure of their ZF domains (Additional file 6) and similarities in their functional roles in zinc homeostasis [43-49]. Our alignments of Zap1/ZafA sequences from seven fungal species (Ustilago maydis, Cryptococcus neoformans, Aspergillus fumigatus, Magnaporthe grisea, Candida albicans, Saccharomyces cerevisiae and Yarrowia lipolytica) reveal significant similarity in their ZFDs (Additional file 6). The ZFDs contain a maximum of eight C2H2 ZF motifs in which the two N-terminal ZF pairs (ZF1-ZF2, ZF3-ZF4) can form tCWCH2 motifs. ZF1-2 and ZF3-4 are separated by longer intervening sequences than most ZFs. Our alignments showed that conservation of ZF1, ZF2, and ZF8 was incomplete.
Additional file 6. Sequence alignment of Zap1 and ZafA. Zinc homeostasis genes Zap1 and ZafA have structural similarity. Conservation of ZF8 was weak. Um, Ustilago maydis; Cn, Cryptococcus neoformans; Afu, Aspergillus fumigatus; Mg, Magnaporthe grisea; Yl, Yarrowia lipolytica; Ca, Candida albicans; Sc, Saccharomyces cerevisiae.
Format: PDF Size: 66KB Download file
This file can be viewed with: Adobe Acrobat Reader
Fungus-Gli-like (Fungl)
The amino acid sequences encoded by this group of genes have been known as "fungus Gli like". Here, we have named these sequences Fungl (Fungus-Gli-like) (Additional file 7, data not shown).
Additional file 7. Sequence alignment of zinc finger domain of Fungl, human GLI3, and Fungl-4ZF genes. We propose the common gene name, Fungl: Fungus Gli like. Afu, Aspergillus fumigatus; Nc, Neurospora crassa; Yl, Yarrowia lipolytica; Mgl, Malasszia globosa; Um, Ustilago maydis; Ro, Rhizopus oryzae; Ecu, Encephalitozoon cuniculi; Ca, Candida albicans; Lbi, Laccaria bicolor; Eb, Enterocytozoon bieneusi; Alo, Antonospora locustae; Cn, Cryptococcus neoformans; Hs, Homo sapiens; Bde, Batrachochytrium dendrobatidis.
Format: PDF Size: 60KB Download file
This file can be viewed with: Adobe Acrobat Reader
Zfp106
Zfp106 is a metazoan ZF protein of unknown function [50,51]. It contains two pairs of ZFs at each end. WD40 repeats (IPR001680, Zfp106) are known to mediate protein-protein interactions [52-55].
Tandem-CWCH2-protein-C-terminal (Twincl)
The sequences are composed of 468 to 1458 amino acid residues (data not shown). On the basis of these structural features (Figure 2, Additional file 8), we named this gene family Twincl (Tandem CWCH2 protein C-terminal).
Additional file 8. Sequence alignment of Twincl zinc finger domain. Based on its structural features, we named this gene family Twincl (Tandem CWCH2 protein C-terminal). Afu, Aspergillus fumigatus; Nf, Neosartorya fischeri; Cim, Coccidioides immitis; Pn, Phaeosphaeria nodorum; Gz, Gibberella zeae; Mgr, Magnaporthe grisea; Nc, Neurospora crassa.
Format: PDF Size: 41KB Download file
This file can be viewed with: Adobe Acrobat Reader
Clr1
The ZFs among members of the Clr1 family [56] were highly divergent and other sequences were not conserved (Additional file 9, data not shown). Therefore, we omitted this gene family from the consensus sequence and phylogenetic tree analyses.
Additional file 9. Sequence alignment of Clr1 zinc finger domain. Spo, Schizosaccharomyces pombe; Sj, Schizosaccharomyces japonicus; Cn, Cryptococcus neoformans.
Format: PDF Size: 40KB Download file
This file can be viewed with: Adobe Acrobat Reader
Fungus-Gli-like-4ZF (Fungl-4ZF)
This gene group includes annotations from Rhizopus oryzae and Batrachochytrium dendrobatidis representing the fungal phyla Mucoromycotina and Chytridiomycota, respectively. The proteins encoded by the Fungl-4ZF gene family contain four ZFs that are weakly similar to those in Gli and Fungl (Additional file 7). Based on the ZF motif organization, we tentatively grouped them separately from Fungl. However, based on their sequence similarity and phylogenetic classification it is possible that the Fungl-4ZF and Fungl gene groups are derived from a common ancestral gene [57,58].
Dictyostelium discoideum tCWCH2
The social amoeba Dictyostelium discoideum belongs to the Amoebozoa supergroup. There are two tCWCH2-containing genes in this gene class, DdHp1 (Dictyostelium discoideum hypothetical protein) and DdHp2. The ZFD alignment of these genes is shown in Additional file 10.
Additional file 10. Sequence alignment of Monosiga, Dictyostelium, and plant gene. (A) Zinc finger domain alignment of Dictyostelium discoideum hypothetical protein (DdHp) and Monosiga brevicollis tCWCH2. DdHp2 contains two tCWCH2 domains {ZF12 (ZF1-ZF2) and ZF34 (ZF3-ZF4)}. (B) Plant REF6 Physcomitrella patens (XP_001771543) gene has tCWCH2 sequence. It has strong homology to Arabidopsis REF6 (NP_680116), Oryza sativa gene (NP_001045137) and Vitis vinifera (CAO64178) gene, but the tryptophan residue is not conserved in Arabidopsis and other plants. An alignment of zinc finger domain of these genes is shown. Amino acid identity between sequences is shown by a dot (.).
Format: PDF Size: 58KB Download file
This file can be viewed with: Adobe Acrobat Reader
Monosiga brevicollis tCWCH2
Since Monosiga brevicollis is the only species among the choanoflagellates in which the genome has been fully sequenced, the presence of one tCWCH2 sequence (Additional file 10) may be more functionally meaningful than the singleton sequences in metazoa and fungi. The existence of an RFX domain (position 376-423) raised the possibility that the tCWCH2 sequence in Monosiga brevicollis and Arid2/Rsc9 is derived from a common ancestral gene.
Unclassified sequences
Six sequences were not classified into the above 13 categories (Additional file 2). Four out of the six unclassified sequences contained weak similarities to PacC, Fungl, Fungl-4ZF, and Mizf. The remaining two sequences from fungi did not show any significant homology to the other sequences.
Isolated tCWCH2 in metazoan gene families
We found rare occurrences of the tCWCH2 motif in some metazoan gene families, including three tCWCH2-containing sequences in the Sp8 family (n = 37), one in the TRP2 family (n = 8), one in the Krüppel-like factor 5 family (n = 14), and one in the pbrm-1 family (n = 21) (Additional file 2). We did not include these genes in the following analysis because their significance was not clear.
tCWCH2 sequences in plant databases
Two plant tCWCH2-containing sequences were found. One sequence (XP_001771543) was the REF6 homolog of a moss (Bryophyta, Physcomitrella patens) (Additional file 10). Although REF6 is conserved in many plants, the CWCH2 was not found in other plant species including Arabidopsis thaliana, Oryza sativa, and Vitis vinifera (Additional file 10). The other sequence, AK110182, was from Oryza sativa but is highly homologous to PacC. This sequence was otherwise only detected in fungi and therefore might represent contamination of Oryza sativa with fungal material.
In the course of the classification procedure, we extracted the sequences belonging to each gene family irrespective of the presence of tCWCH2 motifs identified by BLAST search using representative entire amino acid sequences. Within this group, we examined the extent of conservation of the cysteine, tryptophan, and histidine residues contributing to the tCWCH2 motifs. The analysis indicated that the tryptophans in CWCH2 motif-constituting residues were generally conserved (87%-100%) (Table 1).
Table 1. Conservation of the tryptophan residues for the tCWCH2 motif in each gene family.
Similarity among tCWCH2 gene classes
We performed molecular phylogenetic analyses to identify similarities among the tCWCH2 gene classes. For this purpose, we selected flanking ZFs containing tCWCH2 (tCWCH2+1ZF) because the tCWCH2 itself yielded very little information on sequence similarities, presumably because it is short. In addition, genes widely distributed among fungi or metazoa were used for this analysis because our preliminary analysis suggested that genes with a narrow phylogenetic distribution (Twincl, Clr1, Fungl-4ZF, Dictyostelium tCWCH2) had strongly divergent sequences that may confound the phylogenetic tree analyses [59]. Using the tCWCH2+1ZF (3ZFs) amino acid sequences, we constructed phylogenetic trees by the Bayesian inference (BI), maximal likelihood (ML), and neighbor joining (NJ) methods. The 89 (80 tCWCH2 + 9 TFIIIA) sequences, representing a wide phylogenic range, were subjected to this analysis using the DNA-binding classical C2H2 ZFs of TFIIIA as outgroup sequences (Figure 3; sequence alignment in Additional file 11; detailed tree in BI, ML, NJ in Additional files 12, 13 and 14).
Additional file 11. Sequence alignment for phylogenic tree analysis. Conserved cysteine and histidine residues are indicated with an asterisk (*). Afr, Artemia franciscana; Afu, Aspergillus fumigatus; Aga, Anopheles gambiae; Alo, Antonospora locustae; Ape, Asterina pectinifera; Bde, Batrachochytrium dendrobatidis; Bfl, Branchiostoma floridae; Cin, Ciona intestinalis; Cn, Cryptococcus neoformans; Co, Corbicula sp.; Da, Dicyema acuticephalum; Dd, Dictyostelium discoideum; Dj, Dugesia japonica; Dm, Drosophila melanogaster; Hr, Halocynthia roretzi; Hs, Homo sapiens; Hv, Hydra vulgaris; Lbl, Loligo bleekeri; Mms, Mus musculus; Nf, Neosartorya fischeri; Nve, Nematostella vectensis; Oo, Octopus ocellatus; Pi, Pandinus imperator; Ro, Rhizopus oryzae; Sc, Saccharomyces cerevisiae; Sm, Schistosoma mansoni; Sp, Strongylocentrotus purpuratus; Sso, Spisula solidissima; Ssu, Scolionema suvaense; Ta, Trichoplax adhaerens; Tt, Tubifex tubifex; Um, Ustilago maydis; Xl, Xenopus laevis; Yl, Yarrowia lipolytica.
Format: PDF Size: 38KB Download file
This file can be viewed with: Adobe Acrobat Reader
Additional file 12. BI tree of tCWCH2+1ZF. BI tree analysis was performed on 8 × 106 generations using WAG model. Average standard deviation of split frequencies was lower than 0.001 at the end of the analysis. Abbreviations are the same as those in Additional file 11.
Format: PDF Size: 20KB Download file
This file can be viewed with: Adobe Acrobat Reader
Additional file 13. ML tree of tCWCH2+1ZF. ML tree analysis was performed using WAG model with "empirical base frequencies", "maximum likelihood search", and "estimate proportion of invariable sites" options of RAxML [75]. 100 replicates were set for the bootstrap analysis. Abbreviations are the same as those in Additional file 11.
Format: PDF Size: 20KB Download file
This file can be viewed with: Adobe Acrobat Reader
Additional file 14. NJ tree of tCWCH2+1ZF. NJ tree analysis was performed using JTT model and "pair wise deletion", "Rate among site = different (gamma distribution = 0.62)" options of MEGA4 (http://www.megasoftware.net/ webcite, [73,74]). The gamma distributions alpha parameter was calculated by "Tree-Puzzle" (http://www.tree-puzzle.de/ webcite, [72]). 1000 replicates were set for the bootstrap analysis. Abbreviations are the same as those in Additional file 11.
Format: PDF Size: 20KB Download file
This file can be viewed with: Adobe Acrobat Reader
Figure 3. Phylogenic tree of tCWCH2. (A) Tree indicating similarities among the tCWCH2 gene classes. Statistical analysis
was performed using three ZFs (tCWCH2 and a ZF in the C-terminal flanking region).
(B) Sub-tree of Zic/Gli/Glis class gene. The alignment for this analysis is shown
in Additional file 11. BI, NL, and NJ analyses were carried out to construct the molecular phylogenetic
trees (Additional files 12, 13 and 14). The tree pattern is based on the BI tree. Scores for each branch indicate the statistical
support values obtained in each phylogenetic tree construction method {BI (postprobability)/ML
(bootstrap value)/NJ (bootstrap value)}. The absence of scores (-) indicates the branches
that were not supported by the corresponding methods.
Each class of tCWCH2-containing genes was strapped with high bootstrap values in the BI, ML, and NJ methods, supporting the validity of the above classification. Phylogenetic tree analyses revealed the relationships among the tCWCH2 gene families and revealed a novel relationship among the metazoan Zic, Gli, and Glis gene families. These three gene families were grouped together, whereas Gli and Glis formed a sub-group in the branch of the Zic/Gli/Glis group. It is known that vertebrate Zic, Gli, and Glis are composed of six, three, and three paralogs, respectively. Interestingly, Glis2 and Glis3 were separately grouped with their insect homologs (DmGlis2 and DmGlis3 respectively) and sea anemone Nematostella homologs (NveGlis2 and NveGlis3 respectively; Additional files 12, 13 and 14), indicating that the two paralogs existed in the common ancestors of cnidarians and bilaterians. On the other hand, vertebrate Zic and Gli paralogs were not grouped with the invertebrate homologs (Additional files 12, 13 and 14), suggesting that vertebrate Zic and Gli paralogs were generated in vertebrate ancestors.
Fungl was determined to have sequence similarity with the Zic/Gli/Glis group. The Fungl group branch was always located closest to the Zic/Gli/Glis group in the BI, ML, and NJ trees, but statistical support was weak (BI, 93%). The other gene groups with more than two classes of tCWCH2 motif were not strongly supported (BI, <70%). However, Zap1/ZafA class and Aebp2 class proteins were grouped together by the BI and ML methods, and the PacC family was placed in the basal root of the BI and ML trees beside the other tCWCH2+ZF1 sequences from metazoa and fungi.
Distribution of the tCWCH2 sequences in the phylogenetic tree
Based on the above analysis, we investigated the phylogeny of the tCWCH2 motif (Figure 3). In global terms, tCWCH2 sequences were detected in all of the organisms we examined in the Opisthokonta supergroup, including metazoa, fungi, choanoflagellate (Monosiga brevicollis) and microsporidia (Encephalitozoon cuniculi). In the Amoebozoa supergroup, we found two tCWCH2-containing genes in the social amoeba Dictyostelium discoideum, but not in Entamoeba histolytica. Apart from Opisthokonta and Amoebozoa, two sequences were found in the Plantae databases, but their meaning is not clear. Thus, it appears that the distribution of the tCWCH2 sequence motif is essentially limited to the Uniconta (a collective term for the Opisthokonta and Amoebozoa supergroups) in current sequence databases.
We examined the distribution of each tCWCH2 motif class in the phylogenetic tree (Figure 4). Arid2/Rsc9 class genes were most widely detected in both fungi and metazoa. On the other hand, tCWCH2 was not detected in the sequences from the order Saccharomycetales (NP_013579, Saccharomyces cerevisiae; XP_718578, Candida albicans; XP_506030, Yarrowia lipolytica). Zic/Gli/Glis, Aebp2, and Mizf were widely distributed in metazoan groups, but Zfp106 was detected only in Bilateralia except Ecdysozoa. PacC, Zap1/ZafA, and Fungl class genes were widely distributed among the fungi groups. Distribution of Twincl class genes was restricted to Aspergillus and its close relatives. Clr1 class sequences were found only in Schizosaccharomyces and Cryptococcus. Fungl-4ZF class genes were recovered only from the basal fungi (Rhizopus oryzae and Batrachochytrium dendrobatidis).
Figure 4. Distribution of tCWCH2-containing genes in a eukaryotic phylogenetic tree. Tree pattern (gray curved lines) is based on [78-80]. The distribution of tCWCH2 sequences is indicated by the black curved line. The
distribution of each tCWCH2 gene class is indicated by a colored area. The Monosiga tCWCH2 sequence may be derived from the common ancestor of Arid2/Rsc9 (See Results).
Additional sequence features in the tCWCH2 motifs
We generated tCWCH2 consensus sequences for each gene class as well as for all classes to identify any additional sequence features. The Prosite database PDOC00028 alignment was used for the reference consensus sequence of general C2H2. The extent of conservation is indicated by the size of letters, and the consensus sequences are aligned graphically (Figure 5). Classical C2H2 ZFs are known to have a consensus sequence of "(F/Y)xCx2CxFx7Lx2Hx4H" [1]. The tCWCH2 motifs also contain conserved phenylalanine and leucine residues between the cysteine and histidine residues. Phenylalanine and leucine are hydrophobic residues that generally mediate a hydrophobic interaction within a single ZF (data not shown). These data indicate that the general structure of a single ZF is well conserved in the tCWCH2 motif (Figure 6A) and that there are some tCWCH2-specific structures apart from the conserved tryptophan residues.
Figure 5. Sequence conservation among the classes of tCWCH2 sequence motifs. Amino acid sequences were aligned and consensus sequences were generated (see Methods).
Mizf ZF1-2, Mizf ZF3-4, and Zap1/ZafA ZF1-2 and ZF3-4 are indicated separately. The
PDOC00028 C2H2 consensus is shown at the bottom as a general C2H2 consensus sequence
(indicated by the tandem repeat of the consensus sequence). The short insertion sequences
listed below were initially located at the sites indicated by the colored arrowheads
in the alignments described above, but were separated to allow more comprehensive
analyses. These sequences represent the longer linker sequences and the insertion
of extra sequences described in the Results section. To achieve this analysis we omitted
the four sequences AAWT01013938 (Schmidtea mediterranea Aebp2), CAG05504 (Tetraodon nigroviridis Gli), XP_001602003 (Nasonia vitripennis Gli), and XP_785526 (Strongylocentrotus purpuratus Gli) because these sequences contain exceptionally divergent sequences that disrupt
the alignments.
Figure 6. ϕ1 and ϕ2 positions of tCWCH2. (A) Stereo view of the tCWCH2 sequence motif. A wire model of the main chains is
shown with ZIC3, GLI1, and Zap1 in green and TFIIIA and Zif268 in red. The side chains
of tryptophan residues in tCWCH2 and those in the ϕ1, ϕ2 residues are indicated by
cylinders. ZIC3, GLI1, and Zap1 are gray cylinders and the others are red cylinders.
The corresponding positions (ϕ1, ϕ2) are indicated by red boxes in Figure 5. (B) Frequency
of amino acid appearance in ϕ1, ϕ2, and those of general C2H2 (PDOC00028) is shown.
Valine, leucine, and isoleucine appear frequently at both positions and methionine
frequently appears in ϕ2. This table summarizes all of the tCWCH2 sequences. Highlighted
numbers indicate the preferential residues for ϕ1 and ϕ2 in tCWCH2.
Firstly, a position-specific bias to hydrophobic residues was found in the C-terminal region adjacent to the first histidine residue in ZF1 and ZF2 (ϕ1, ϕ2 in Figure 5, 6A). Valine, leucine, and isoleucine were frequently found at ϕ1 position (34.1%, 22.0%, and 35.3%, respectively), and valine, leucine, isoleucine, and methionine were frequently found at ϕ2 position (14.3%, 14.3%, 39.1%, and 24.2%, respectively) in contrast to those in a compilation of general C2H2 sequences (PDOC00028) (valine, 4.2%; leucine, 9.5%; isoleucine, 5.3%; methionine, 7.8%; Figure 6B). The difference in the summed frequency of each position was statistically significant (ϕ1, P < 1 × 10-100; ϕ2, P < 1 × 10-100 in a χ2 test). These positions were close to the tryptophan residues on the opposite side of the ZF as determined in the superimposed 3D structures of Zic, Gli, and Zap1 tCWCH2s (Figure 6A). The biased residue frequency may reflect the spatial restriction of amino acid choices. Since the CWCH2 structure suggests the presence of four hydrophobic residues in a compact space, the residue paired with each tryptophan could not be a residue with a large side chain, such as phenylalanine or tryptophan.
Secondly, the linker sequence of the two ZFs in tCWCH2 was significantly longer (11.8 ± 4.4 aa, average ± standard deviation) than those of general C2H2 sequences (Prosite PDOC00028, 8.1 ± 5.0 aa) (P < 1 × 10-100, Mann-Whitney U-test, Figure 7). There were no canonical TGE(K/R)P-like sequences in the tCWCH2 linker sequences, whereas the TGE(K/R)P linker sequence was found in about 65% of the sequences in the PDOC00028 alignment. Accordingly, conservation of the tCWCH2 linker sequences was generally low (Figure 5), and their lengths were more strongly divergent than those of TGE(K/R)P ZFs (P = 3 × 10-7, F-test). Elongation of the linker was commonly found in the Zap1/ZafA (ZF1-2, 16.2 ± 5.7 aa), Mizf (ZF1-2, 19.2 ± 4.4 aa; ZF3-4, 17.5 ± 2.3 aa) and Arid2/Rsc9 (14.0 ± 6.9 aa) classes.
Figure 7. Comparison of linker length between the tCWCH2 sequence motif and general C2H2 ZF. The bars indicate the mean lengths of the linker sequence between C2H2 motifs in
the indicated groups. We defined the linker length as the number of amino acids between
the last histidine of a ZF and the first cysteine of the C-terminally flanking ZF.
The PDOC00028 (general C2H2) alignment contained 12326 sequences and we found 10025
linkers in it. The general C2H2 sequences was further divided into two groups based
on the presence or absence of "TGE(K/R)P". The sequence numbers of each group: tCWCH2,
614; general C2H2, 10025; "TGE(K/P)", 4640; "non-TGE(K/R)P", 5385). Error bar, standard
deviation. *, P < 1 × 10-100 in Mann-Whitney U-test.
Thirdly, extra sequences were inserted between the tryptophan and cysteine residues in tCWCH2. This type of insertion was limited to the sequences from the first ZF of Zic/Gli/Glis, Arid2/Rsc9, and Zap1/ZafA and the second ZF of Arid2/Rsc9 classes. The number of amino acid residues between the two cysteines of tCWCH2 varied from four to 34 and was mostly four residues in other classes [15]. This insertion forms an extra looping structure in ZIC3 (PDBID: 2RPC; Figure 1, 6A) [13].
Discussion
The tCWCH2 motif is a hallmark of inter-zinc finger interactions
The tCWCH2 motif was originally proposed as an evolutionarily conserved sequence involved in the interaction between ZFs in human ZIC3 [13,15]. The presence of the tCWCH2 motif in the Gli family, Glis family, Zap1, and PacC has been previously reported [13]. Superimposition analysis revealed a tightly conserved structure among ZIC3, GLI, and Zap1, supporting the importance of the tCWCH2 motif in structural terms. Strong conservation of the tCWCH2 tryptophan residues in each gene class suggests that there has been strong selective pressure for them during evolution.
Our analysis revealed additional structural features of tCWCH2 besides the conserved tryptophans, which may be explained by adaptation of its role in mediating the inter-ZF interaction (Figure 8). Firstly, there is a preference for valine, leucine, or isoleucine in the ϕ1 and ϕ2 position. This can be regarded as an adaptive adjustment for forming hydrophobic cores of the appropriate size. Furthermore, hydrophobic interaction between ϕ1 and ϕ2 is likely because they are closely located within 4Å distance in the 3D structure models of ZIC3, GLI and Zap1 (Additional file 1, data not shown). This also can influence the amino acid preferences in ϕ1 and ϕ2 position. Secondly, elongation of the linker sequences may also reflect a structural adaptation to allow the motif to face the two globular C2H2 units. Linker length and sequence are important for the function of the DNA-binding C2H2 ZF, because they determine the distance of each ZF and the linker contacts to the DNA base [60-62]. However, optimization of the canonical linker length for DNA-binding may not be enough to yield opposed positioning of ZF units. The bending between the two ZFs may be larger than is dictated by the DNA binding state of the ZFs as revealed in the GLI-DNA complex structure [7]. Longer linker size seems to be a general feature of tCWCH2, but conservation of the linker sequences within each class varies notably. Linker conservation in PacC is particularly high, despite the widespread distribution of this gene in fungi, thus suggesting that the linker in PacC is under evolutionary constraint.
Figure 8. Evolution of the tCWCH2 domain. We propose that the tCWCH2 patterns were generated from classical C2H2 sequences
concurrently with the acquisition of the additional sequence features.
Another structural feature, the addition of extra sequences, is plausible if we assume the reduction of structural constraint as a consequence of specialization in the inter-ZF interaction. For example, the conservation of tCWCH2-forming ZF1 is lower than that of ZF2-5 in Zic proteins [15]. In the case of the GLI-DNA complex, the tCWCH2-forming ZF1 does not directly participate in DNA binding [12], and the sequence conservation of Gli family ZF1 is also lower than in ZF2-5 (Figure 5, unpublished observation). The extra sequences in the Zic/Gli/Glis, Zap1/ZafA (ZF3-4), and Arid/Rsc9 classes show poor conservation (Figure 5).
It is unclear if tCWCH2 is the only structure required for inter-ZF interactions. The C2H2 ZFD is capable of achieving protein-to-protein interactions in many cases [6]. Interestingly, in a previous study to design synthetic ZFs utilizing in vitro-evolving protein-to-protein interactions [16], it was found that the hydrophobic residues in zif268 that interacted between the artificial proteins and the zif268 C2H2 ZF were similar to those involved in the GLI inter-ZF interaction. Superimposition revealed that the position corresponding to the tryptophan in tCWCH2 is occupied by a valine, suggesting that either intramolecular or intermolecular protein-to-protein interactions, mediated by hydrophobic residues, are generally utilized for C2H2 ZFs. However, the strong conservation of the tCWCH2 and accompanying structural features suggest that tCWCH2 is a highly specialized C2H2 ZF for inter-ZF interactions between two adjacent ZFs.
Evolution of the tCWCH2 motif
We hypothesize that the original tCWCH2 motifs were generated from classical C2H2 ZFs (Figure 8) that occur widely in eukaryotic organisms, including Plantae, Excavata, Chromalveolata, and Rhizaria. tCWCH2 motifs were found in the vicinity of C2H2 ZF in several tCWCH2 gene classes. It is proposed that the tCWCH2 sequence appeared in the common ancestor of Opisthokonta or Unikonta (Opisthokonta/Amoebozoa). The acquisition of the tryptophans and additional structural features of tCWCH2 may have occurred concurrently in the course of evolution. Whether the evolution of tCWCH2 occurred once or multiple times during Opisthokonta/Amoebozoa evolution remains unclear. However, its short sequence and some isolated distribution in the plant supergroup and metazoan gene families may favor the multiple-origins hypothesis. Although the lineage relationship among the tCWCH2 classes remains unclear, we can presume the presence of the following tCWCH2 ancestral genes: an Arid2/Rsc9 common ancestor, which may have existed before the diversification of metazoa and fungi; a Zic/Gli/Glis common ancestor, an Aebp2 ancestor, and a Mizf ancestor in the early metazoa; a Fungl ancestor, a PacC ancestor, a Fungl-4ZF ancestor, and a Zap1/ZafA ancestor in the early fungi; a Zfp106 ancestor in early bilaterians; a Twincl ancestor in the founder of Aspergillus and its close siblings; and a Clr1 ancestor in the founder of Dikarya, althogh most Dikarya may have lost the gene. Once the tCWCH2 structures were established, they may have been more strongly conserved in these classes.
Function and role of tCWCH2
There are several cases that directly indicate the functional importance of the tCWCH2 motif in living organisms. In the case of PacC, mutation of the tryptophan of tCWCH2 induces a loss of its DNA binding activity [31,32]. In case of human ZIC3, the tryptophan mutation is proposed to be associated with the occurrence of a familial congenital heart defect, and biochemical analysis revealed that transcriptional activity and protein stability are decreased in the mutant protein [13,14]. In yeast Zap1, interaction between the two ZF where the tCWCH2 motif is located is required for the high-affinity binding of the zinc ion [45]. Also, it has been shown that the inter-ZF interaction is influenced by the concentration of zinc ion [46], suggesting that the tCWCH2 motif is involved in zinc-sensing in yeast.
Apart from the instances referred to above, the functional significance of the tCWCH2 domain remains unknown. We propose that tCWCH2 may play roles other than the direct DNA binding that is often exerted by classical C2H2, because the linker lengths of tCWCH2 are more highly divergent than those of the canonical C2H2 ZFs, in which linker length is a critical parameter for DNA-C2H2 ZF interactions [60-63]. Furthermore, the structure of GLI, ZIC3, and Zap1 tCWCH2 domains, in which the two adjacent ZFs form a single globular structure [7,13,47], is clearly different from the structure of the DNA-binding C2H2 ZF domain where each globular ZF unit wraps around the major groove of the DNA [7-11,64] (PDBID: GLI, 2GLI; YY1, 1UBD; WT1, 2RPT; Zif268, 1MEY, 1P47; TFIIIA; 1TF3). In the case of GLI tCWCH2, which is the only tCWCH2 with a known DNA-binding 3D structure, the N-terminal ZF of GLI1 tCWCH2 does not contact DNA [7].
Assuming that the tCWCH2 domain has a function other than DNA binding, what roles could tCWCH2 play? Firstly, our domain structure analysis implies that tCWCH2 likely regulates its neighboring domains, such as canonical C2H2 ZF, WD40, and LIL. Zic/Gli/Glis, PacC, Mizf, Aebp2, Zap1/ZafA, Fungl, Clr1, and Fungl-4ZF possess canonical ZF(s) in the C-terminal flanking region of the tCWCH2. In the case of PacC, analyses of CWCH2 motif-containing tryptophan mutants suggests that DNA binding mediated by ZF2 and ZF3 may be influenced by tCWCH2 motifs in ZF1 and ZF2 [32]. It is possible that tCWCH2 motifs in the other members of this group act similarly in the regulation of neighboring canonical C2H2 domains. In transcription factors, DNA binding domains such as the canonical C2H2 ZF, can define a target sequence and fix the protein position (angle, distance, direction) with respect to the DNA. The tCWCH2 motif could provide a 'hinge' or modulatory junction that controls the relative positioning of other functional domains. Secondly, tCWCH2 motifs may provide a capping structure that isolates the structural influence of N-terminal flanking region. In the case of ZIC3, mutations in its tCWCH2 motif increase the random coil contents more than the zinc-free state [13]. A unique terminal structure in a domain composed of repeating structural motifs is also seen in other conserved domains [65-67]. In the case of small leucine-rich repeats and ankyrin repeats, N-capping structures are responsible for protein stability [66,67]. Thirdly, tCWCH2 binding to other molecules is possible, and is observed for many conserved domains. Transcriptional regulator and chromatin remodeling proteins form complexes with many different proteins in order to be functionally active [68,69]. Therefore, the tCWCH2 ZF may not be associated with DNA binding but may serve in protein recognition similar to many C2H2 ZFs [5].
The distribution and conservation of the tCWCH2 sequence motif in various gene classes suggests that this motif has important biological roles. The genes we identified containing one or more tCWCH2 motifs are known to be involved in various biological processes, including chromatin remodeling (Arid2/Rsc9), zinc homeostasis (Zap1/ZafA), pH sensing (PacC), cell cycle regulation, and transcriptional regulation (Zic/Gli/Glis, PacC, Mizf, Aebp2, Zap1/ZafA). In addition, given that several gene classes remain to be functionally characterized (including Fungl, Zfp106, Twincl, Clr1, Fungl-4ZF, Monosiga gene, DdHp), the known functional repertoire of the tCWCH2 motif is likely to increase. We propose that the tCWCH2 sequence motif is a widespread and functional protein structural motif and that further structural and functional analyses are required to fully understand its roles in biological processes.
Conclusions
(1) The 3D structure of tCWCH2 is highly conserved among human ZIC3, human GLI1, and yeast Zap1.
(2) Current databases contained 587 tCWCH2 sequences that can be classified into 11 major gene classes (Zic/Gli/Glis, Arid2/Rsc9, PacC, Mizf, Aebp2, Zap1/ZafA, Fungl, Zfp106, Twincl, Clr1, and Fungl-4ZF) and other minority classes. The tCWCH2 motifs were found in transcription regulatory factors, chromatin remodeling factors, and pH/zinc homeostasis regulating factors.
(3) The tCWCH2 motif is mostly found in Opisthokonta (metazoa, fungi, and choanoflagellates) and Amoebozoa (amoeba, Dictyostelium discoideum).
(4) The tCWCH2 motif contains three additional structural features: (i) bias to hydrophobic residues in the ϕ1 and ϕ2 positions, (ii) longer linkers between the two C2H2 motifs, and (iii) insertion of extra sequences. The structural features suggest that the tCWCH2 motif is a specialized motif involved in inter-zinc finger interactions.
Methods
Protein structural analysis
Protein structures were obtained from the NCBI (National Center for Biotechnology Information) database as PDB format files and we used iMol http://www.pirx.com/iMol/ webcite and Swiss-PdbViewer http://spdbv.vital-it.ch/ webcite as the PDB viewer applications. The latter was also used for superimposing multiple protein structures. Magic fit options were selected for the superimposition of structure data because the number of amino acid residues was different between proteins. Zif268 (PDBID: 1P47) and TFIIIA (PDBID: 2J7J) were used for the reference structure of the classical C2H2 ZF. For the distance analysis of the neighboring amino acid residues, we used "Neighbors of Selected Residue Side chain" option of the Swiss-PdbViewer. The software showed the list of the neighboring residues with distances. We dealt with the residues if the same residues were detected as the neighbors in more than 10 models of ZIC3 and Zap1 PDB files that include 20 models respectively.
Database search
We conducted web-based BLAST searches using Pattern Hit Initiated (PHI)-BLAST of NCBI databases http://blast.ncbi.nlm.nih.gov/Blast.cgi webcite. For the sequence pattern of the PHI-BLAST searches, we used "xCxWx(2,35)Cx(5,15)Hx(2,5)Hx(5,25)CxWx(1,3)Cx(5,17)Hx(2,5)Hx". The initial sequence pattern was deduced from the compilation of the Zic family sequences [15,70] and subsequently the intervening sequence lengths were modified to the above pattern until no additional sequences appeared in the search. The seed sequences obtained by PHI-BLAST search were first classified into gene families based on their annotation and on phylogenetic tree analyses (see below). Then a TBLASTN search was performed against (1) all of the following databases: GenBank+RefSeq Nucleotides+EMBL+DDBJ+PDB excluding whole-genome shotgun sequences and expressed sequence tags (nr option in the NCBI, TBLASTN search), and (2) whole genome shotgun sequences of the organisms shown in Table 2. The whole genome sequence TBLASTN search was performed using representative sequences for each gene family (Table 3) initially on a eukaryote-wide basis, and then on a metazoa-and-fungus-wide basis. For the metazoa-and-fungus-wide search, sequences closely related to the selected genes were searched in the following gene-species combinations: Arid2/Rsc9, PacC, Zap1/ZafA, Fungl, Twincl, Clr1, and Fungl-4ZF were searched in fungi; and Zic/Gli/Glis, Arid2/Rsc9, Mizf, Aebp2, and Zfp106 were searched in metazoa. The target organisms are listed in Table 2. These organisms were selected on the basis of the following criteria: (1) high genome sequence coverage (>5×), (2) member of a major Eukaryote taxon or considered to be in a phylogenetically important position. The collected sequences were manually checked for the presence of the sequence of the tCWCH2 motif. In addition, we performed protein BLAST searches using representative sequences for 16 gene families (Aebp2, Arid2, Clr1, Csr1, Fungl, Fungl-4ZF, Gli, Glis, Mizf, PacC, Rsc9, Twincl, ZafA, Zap1, Zfp106, Zic) irrespective of the presence of the tCWCH2 motif. These searches revealed the extent of tCWCH2 motif conservation in each gene family. Redundant sequences derived from a single gene in a single species were removed from the collected sequences except for one representative sequence. We obtained 587 non-redundant sequences containing the tCWCH2 sequence motif.
Table 2. Eukaryotic organisms used for the TBLASTN search.
Table 3. Query sequences for the TBLASTN search.
For the re-evaluation of the initial PHI-BLAST pattern, we generated a tCWCH2 consensus sequence of "LVCKWDGCSEKLFDSPEELVDHVCEDHVGTQLEYTCLWKGCDRFPFKSRYKLIRHIRSHTGEKP". This sequence was constructed using the following steps: (1) alignment of tCWCH2 by ClustalX software [71], (2) elimination of positions where the frequency of the inserted space "-" was >50%, (3) selection of the amino acid residues most frequently appearing in each position. We performed PHI-BLAST again using four patterns (Additional file 3).
Conserved protein domains in the collected sequences were identified by searching the Conserved Domain Database http://www.ncbi.nlm.nih.gov/Structure/cdd/cdd.shtml webcite that included domains imported from Pfam and SMART databases.
Sequence analysis
Amino acid sequences of the tCWCH2 motif and one C2H2 ZF in the carboxy flanking were aligned using ClustalX software [71] with default parameter settings. The final adjustment of the alignment was performed manually. For the phylogenic tree analyses, MEGA4 {Neighbor-Joining tree (NJ, JTT model, alpha value was determined by Tree-Puzzle [72]), http://www.megasoftware.net/ webcite, [73,74]}, RAxML {Maximal Likelihood (ML, WAG model) tree, http://phylobench.vital-it.ch/raxml-bb/ webcite, [75]}, and MrBayes3.1.2 {Bayesian Inference (BI, WAG model) tree, [76]} were used. To generate the consensus sequence figure, the aligned sequence was subjected to a web-based analysis, WebLogo http://weblogo.berkeley.edu/ webcite[77]. The PDOC00028 alignment in the Prosite database (12328 sequences, http://au.expasy.org/prosite/ webcite) was used for the reference sequence representing the general C2H2 domain. This alignment was entered directly into WebLogo and subjected to linker length analysis. We aligned all of the sequences and then extracted the alignment of each taxon to generate the hierarchically ordered alignment of the consensus sequences. The linker sequence length between the two C2H2 ZF motifs was defined by the number of amino acid residues between the C-terminal histidine residue of the first ZF and the N-terminal cysteine residue of the second ZF.
The PDOC00028 sequence alignment contains the gene name and species together with the start and end position number (e.g., GLI1_HUMAN/301-330). We calculated the linker length by subtracting the end-position number from the start-position number for two ZFs. We excluded linker lengths that were too long (>41), because the average length of general C2H2 sequences (PDOC00028) was 27.95 (n = 12328, standard deviation = 1.39, max. = 42, min. = 10) and the maximum linker length of tCWCH2 was 37.
List of abbreviations
3D: three-dimensional; tCWCH2: tandem CWCH2; ZF: zinc finger; ZFD: zinc finger domain.
Authors' contributions
MH carried out the sequence alignment, 3D structure analysis, and statistical analysis. JA conceived and designed the study, and analyzed the data. MH and JA wrote the paper and approved the final manuscript.
Acknowledgements
We acknowledge Dr. Hideko Urushihara (Tsukuba University) for valuable discussions concerning the Dictyostelium genes. This study was funded by the RIKEN Brain Science Institute and Grant-in-Aid for Challenging Exploratory Research (21657034) from Japan Society for the Promotion of Science.
References
-
Wolfe SA, Nekludova L, Pabo CO: DNA recognition by Cys2His2 zinc finger proteins.
Annu Rev Biophys Biomol Struct 2000, 29:183-212. PubMed Abstract | Publisher Full Text
-
Babu MM, Iyer LM, Balaji S, Aravind L: The natural history of the WRKY-GCM1 zinc fingers and the relationship between transcription factors and transposons.
Nucleic Acids Res 2006, 34:6505-6520. PubMed Abstract | Publisher Full Text | PubMed Central Full Text
-
Krishna SS, Majumdar I, Grishin NV: Structural classification of zinc fingers: survey and summary.
Nucleic Acids Res 2003, 31:532-550. PubMed Abstract | Publisher Full Text | PubMed Central Full Text
-
Brown RS: Zinc finger proteins: getting a grip on RNA.
Curr Opin Struct Biol 2005, 15:94-98. PubMed Abstract | Publisher Full Text
-
Brayer KJ, Segal DJ: Keep your fingers off my DNA: protein-protein interactions mediated by C2H2 zinc finger domains.
Cell Biochem Biophys 2008, 50:111-131. PubMed Abstract | Publisher Full Text
-
Gamsjaeger R, Liew CK, Loughlin FE, Crossley M, Mackay JP: Sticky fingers: zinc-fingers as protein-recognition motifs.
Trends Biochem Sci 2007, 32:63-70. PubMed Abstract | Publisher Full Text
-
Pavletich NP, Pabo CO: Crystal structure of a five-finger GLI-DNA complex: new perspectives on zinc fingers.
Science 1993, 261:1701-1707. PubMed Abstract | Publisher Full Text
-
Foster MP, Wuttke DS, Radhakrishnan I, Case DA, Gottesfeld JM, Wright PE: Domain packing and dynamics in the DNA complex of the N-terminal zinc fingers of TFIIIA.
Nat Struct Biol 1997, 4:605-608. PubMed Abstract | Publisher Full Text
-
Pavletich NP, Pabo CO: Zinc finger-DNA recognition: crystal structure of a Zif268-DNA complex at 2.1 Å.
Science 1991, 252:809-817. PubMed Abstract | Publisher Full Text
-
Houbaviy HB, Usheva A, Shenk T, Burley SK: Cocrystal structure of YY1 bound to the adeno-associated virus P5 initiator.
Proc Natl Acad Sci USA 1996, 93:13577-13582. PubMed Abstract | Publisher Full Text | PubMed Central Full Text
-
Stoll R, Lee BM, Debler EW, Laity JH, Wilson IA, Dyson HJ, Wright PE: Structure of the Wilms tumor suppressor protein zinc finger domain bound to DNA.
J Mol Biol 2007, 372:1227-1245. PubMed Abstract | Publisher Full Text
-
Papworth M, Kolasinska P, Minczuk M: Designer zinc-finger proteins and their applications.
Gene 2006, 366:27-38. PubMed Abstract | Publisher Full Text
-
Hatayama M, Tomizawa T, Sakai-Kato K, Bouvagnet P, Kose S, Imamoto N, Yokoyama S, Utsunomiya-Tate N, Mikoshiba K, Kigawa T, Aruga J: Functional and structural basis of the nuclear localization signal in the ZIC3 zinc finger domain.
Hum Mol Genet 2008, 17:3459-3473. PubMed Abstract | Publisher Full Text | PubMed Central Full Text
-
Chhin B, Hatayama M, Bozon D, Ogawa M, Schon P, Tohmonda T, Sassolas F, Aruga J, Valard AG, Chen SC, Bouvagnet P: Elucidation of penetrance variability of a ZIC3 mutation in a family with complex heart defects and functional analysis of ZIC3 mutations in the first zinc finger domain.
Hum Mutat 2007, 28:563-570. PubMed Abstract | Publisher Full Text
-
Aruga J, Kamiya A, Takahashi H, Fujimi TJ, Shimizu Y, Ohkawa K, Yazawa S, Umesono Y, Noguchi H, Shimizu T, et al.: A wide-range phylogenetic analysis of Zic proteins: implications for correlations between protein structure conservation and body plan complexity.
Genomics 2006, 87:783-792. PubMed Abstract | Publisher Full Text
-
Wang BS, Grant RA, Pabo CO: Selected peptide extension contacts hydrophobic patch on neighboring zinc finger and mediates dimerization on DNA.
Nat Struct Biol 2001, 8:589-593. PubMed Abstract | Publisher Full Text
-
Aruga J: The role of Zic genes in neural development.
Mol Cell Neurosci 2004, 26:205-221. PubMed Abstract | Publisher Full Text
-
Merzdorf CS: Emerging roles for zic genes in early development.
Dev Dyn 2007, 236:922-940. PubMed Abstract | Publisher Full Text
-
Matise MP, Joyner AL: Gli genes in development and cancer.
Oncogene 1999, 18:7852-7859. PubMed Abstract | Publisher Full Text
-
Koebernick K, Pieler T: Gli-type zinc finger proteins as bipotential transducers of Hedgehog signaling.
Differentiation 2002, 70:69-76. PubMed Abstract | Publisher Full Text
-
Zhang J, Tang Q, Zimmerman-Kordmann M, Reutter W, Fan H: Activation of B lymphocytes by GLIS, a bioactive proteoglycan from Ganoderma lucidum.
Life Sci 2002, 71:623-638. PubMed Abstract | Publisher Full Text
-
Attanasio M, Uhlenhaut NH, Sousa VH, O'Toole JF, Otto E, Anlag K, Klugmann C, Treier AC, Helou J, Sayer JA, et al.: Loss of GLIS2 causes nephronophthisis in humans and mice by increased apoptosis and fibrosis.
Nat Genet 2007, 39:1018-1024. PubMed Abstract | Publisher Full Text
-
Senee V, Chelala C, Duchatelet S, Feng D, Blanc H, Cossec JC, Charon C, Nicolino M, Boileau P, Cavener DR, et al.: Mutations in GLIS3 are responsible for a rare syndrome with neonatal diabetes mellitus and congenital hypothyroidism.
Nat Genet 2006, 38:682-687. PubMed Abstract | Publisher Full Text
-
Sakai-Kato K, Ishiguro A, Mikoshiba K, Aruga J, Utsunomiya-Tate N: CD spectra show the relational style between Zic-, Gli-, Glis-zinc finger protein and DNA.
Biochim Biophys Acta 2008, 1784:1011-1019. PubMed Abstract | Publisher Full Text
-
Mizugishi K, Aruga J, Nakata K, Mikoshiba K: Molecular properties of Zic proteins as transcriptional regulators and their relationship to GLI proteins.
J Biol Chem 2001, 276:2180-2188. PubMed Abstract | Publisher Full Text
-
Beak JY, Kang HS, Kim YS, Jetten AM: Functional analysis of the zinc finger and activation domains of Glis3 and mutant Glis3(NDH1).
Nucleic Acids Res 2008, 36:1690-1702. PubMed Abstract | Publisher Full Text | PubMed Central Full Text
-
Damelin M, Simon I, Moy TI, Wilson B, Komili S, Tempst P, Roth FP, Young RA, Cairns BR, Silver PA: The genome-wide localization of Rsc9, a component of the RSC chromatin-remodeling complex, changes in response to stress.
Mol Cell 2002, 9:563-573. PubMed Abstract | Publisher Full Text
-
Mohrmann L, Verrijzer CP: Composition and functional specificity of SWI2/SNF2 class chromatin remodeling complexes.
Biochim Biophys Acta 2005, 1681:59-73. PubMed Abstract | Publisher Full Text
-
Zhang X, Azhar G, Zhong Y, Wei JY: Zipzap/p200 is a novel zinc finger protein contributing to cardiac gene regulation.
Biochem Biophys Res Commun 2006, 346:794-801. PubMed Abstract | Publisher Full Text
-
Tilburn J, Sarkar S, Widdick DA, Espeso EA, Orejas M, Mungroo J, Penalva MA, Arst HN Jr: The Aspergillus PacC zinc finger transcription factor mediates regulation of both acid- and alkaline-expressed genes by ambient pH.
Embo J 1995, 14:779-790. PubMed Abstract | PubMed Central Full Text
-
Fernandez-Martinez J, Brown CV, Diez E, Tilburn J, Arst HN Jr, Penalva MA, Espeso EA: Overlap of nuclear localisation signal and specific DNA-binding residues within the zinc finger domain of PacC.
J Mol Biol 2003, 334:667-684. PubMed Abstract | Publisher Full Text
-
Espeso EA, Tilburn J, Sanchez-Pulido L, Brown CV, Valencia A, Arst HN Jr, Penalva MA: Specific DNA recognition by the Aspergillus nidulans three zinc finger transcription factor PacC.
J Mol Biol 1997, 274:466-480. PubMed Abstract | Publisher Full Text
-
Vincent O, Rainbow L, Tilburn J, Arst HN Jr, Penalva MA: YPXL/I is a protein interaction motif recognized by aspergillus PalA and its human homologue, AIP1/Alix.
Mol Cell Biol 2003, 23:1647-1655. PubMed Abstract | Publisher Full Text | PubMed Central Full Text
-
Sekimata M, Homma Y: Sequence-specific transcriptional repression by an MBD2-interacting zinc finger protein MIZF.
Nucleic Acids Res 2004, 32:590-597. PubMed Abstract | Publisher Full Text | PubMed Central Full Text
-
Sekimata M, Takahashi A, Murakami-Sekimata A, Homma Y: Involvement of a novel zinc finger protein, MIZF, in transcriptional repression by interacting with a methyl-CpG-binding protein, MBD2.
J Biol Chem 2001, 276:42632-42638. PubMed Abstract | Publisher Full Text
-
Sekimata M, Homma Y: Regulation of Rb gene expression by an MBD2-interacting zinc finger protein MIZF during myogenic differentiation.
Biochem Biophys Res Commun 2004, 325:653-659. PubMed Abstract | Publisher Full Text
-
He GP, Kim S, Ro HS: Cloning and characterization of a novel zinc finger transcriptional repressor. A direct role of the zinc finger motif in repression.
J Biol Chem 1999, 274:14678-14684. PubMed Abstract | Publisher Full Text
-
Sedaghat Y, Miranda WF, Sonnenfeld MJ: The jing Zn-finger transcription factor is a mediator of cellular differentiation in the Drosophila CNS midline and trachea.
Development 2002, 129:2591-2606. PubMed Abstract | Publisher Full Text
-
Cao R, Zhang Y: The functions of E(Z)/EZH2-mediated methylation of lysine 27 in histone H3.
Curr Opin Genet Dev 2004, 14:155-164. PubMed Abstract | Publisher Full Text
-
Cao R, Zhang Y: SUZ12 is required for both the histone methyltransferase activity and the silencing function of the EED-EZH2 complex.
Mol Cell 2004, 15:57-67. PubMed Abstract | Publisher Full Text
-
Kim H, Kang K, Kim J: AEBP2 as a potential targeting protein for Polycomb Repression Complex PRC2.
Nucleic Acids Res 2009, 37:2940-2950. PubMed Abstract | Publisher Full Text | PubMed Central Full Text
-
Liu Y, Montell DJ: Jing: a downstream target of slbo required for developmental control of border cell migration.
Development 2001, 128:321-330. PubMed Abstract | Publisher Full Text
-
Zhao H, Eide DJ: Zap1p, a metalloregulatory protein involved in zinc-responsive transcriptional regulation in Saccharomyces cerevisiae.
Mol Cell Biol 1997, 17:5044-5052. PubMed Abstract | Publisher Full Text | PubMed Central Full Text
-
Kim MJ, Kil M, Jung JH, Kim J: Roles of Zinc-responsive transcription factor Csr1 in filamentous growth of the pathogenic Yeast Candida albicans.
J Microbiol Biotechnol 2008, 18:242-247. PubMed Abstract | Publisher Full Text
-
Bird AJ, Zhao H, Luo H, Jensen LT, Srinivasan C, Evans-Galea M, Winge DR, Eide DJ: A dual role for zinc fingers in both DNA binding and zinc sensing by the Zap1 transcriptional activator.
Embo J 2000, 19:3704-3713. PubMed Abstract | Publisher Full Text | PubMed Central Full Text
-
Qiao W, Mooney M, Bird AJ, Winge DR, Eide DJ: Zinc binding to a regulatory zinc-sensing domain monitored in vivo by using FRET.
Proc Natl Acad Sci USA 2006, 103:8674-8679. PubMed Abstract | Publisher Full Text | PubMed Central Full Text
-
Wang Z, Feng LS, Matskevich V, Venkataraman K, Parasuram P, Laity JH: Solution structure of a Zap1 zinc-responsive domain provides insights into metalloregulatory transcriptional repression in Saccharomyces cerevisiae.
J Mol Biol 2006, 357:1167-1183. PubMed Abstract | Publisher Full Text
-
Moreno MA, Ibrahim-Granet O, Vicentefranqueira R, Amich J, Ave P, Leal F, Latge JP, Calera JA: The regulation of zinc homeostasis by the ZafA transcriptional activator is essential for Aspergillus fumigatus virulence.
Mol Microbiol 2007, 64:1182-1197. PubMed Abstract | Publisher Full Text
-
Kim WI, Lee WB, Song K, Kim J: Identification of a putative DEAD-box RNA helicase and a zinc-finger protein in Candida albicans by functional complementation of the S. cerevisiae rok1 mutation.
Yeast 2000, 16:401-409. PubMed Abstract | Publisher Full Text
-
Grasberger H, Bell GI: Subcellular recruitment by TSG118 and TSPYL implicates a role for zinc finger protein 106 in a novel developmental pathway.
Int J Biochem Cell Biol 2005, 37:1421-1437. PubMed Abstract | Publisher Full Text
-
Grasberger H, Ye H, Mashima H, Bell GI: Dual promoter structure of ZFP106: regulation by myogenin and nuclear respiratory factor-1.
Gene 2005, 344:143-159. PubMed Abstract | Publisher Full Text
-
Zuberi AR, Christianson GJ, Mendoza LM, Shastri N, Roopenian DC: Positional cloning and molecular characterization of an immunodominant cytotoxic determinant of the mouse H3 minor histocompatibility complex.
Immunity 1998, 9:687-698. PubMed Abstract | Publisher Full Text
-
Feldman RM, Correll CC, Kaplan KB, Deshaies RJ: A complex of Cdc4p, Skp1p, and Cdc53p/cullin catalyzes ubiquitination of the phosphorylated CDK inhibitor Sic1p.
Cell 1997, 91:221-230. PubMed Abstract | Publisher Full Text
-
Nakayama J, Saito M, Nakamura H, Matsuura A, Ishikawa F: TLP1: a gene encoding a protein component of mammalian telomerase is a novel member of WD repeats family.
Cell 1997, 88:875-884. PubMed Abstract | Publisher Full Text
-
Renault L, Nassar N, Vetter I, Becker J, Klebe C, Roth M, Wittinghofer A: The 1.7 Å crystal structure of the regulator of chromosome condensation (RCC1) reveals a seven-bladed propeller.
Nature 1998, 392:97-101. PubMed Abstract | Publisher Full Text
-
Thon G, Klar AJ: The clr1 locus regulates the expression of the cryptic mating-type loci of fission yeast.
Genetics 1992, 131:287-296. PubMed Abstract | Publisher Full Text | PubMed Central Full Text
-
James TY, Kauff F, Schoch CL, Matheny PB, Hofstetter V, Cox CJ, Celio G, Gueidan C, Fraker E, Miadlikowska J, et al.: Reconstructing the early evolution of Fungi using a six-gene phylogeny.
Nature 2006, 443:818-822. PubMed Abstract | Publisher Full Text
-
Hibbett DS, Binder M, Bischoff JF, Blackwell M, Cannon PF, Eriksson OE, Huhndorf S, James T, Kirk PM, Lucking R, et al.: A higher-level phylogenetic classification of the Fungi.
Mycol Res 2007, 111:509-547. PubMed Abstract | Publisher Full Text
-
Philippe H, Zhou Y, Brinkmann H, Rodrigue N, Delsuc F: Heterotachy and long-branch attraction in phylogenetics.
BMC Evol Biol 2005, 5:50. PubMed Abstract | BioMed Central Full Text | PubMed Central Full Text
-
Laity JH, Dyson HJ, Wright PE: DNA-induced alpha-helix capping in conserved linker sequences is a determinant of binding affinity in Cys(2)-His(2) zinc fingers.
J Mol Biol 2000, 295:719-727. PubMed Abstract | Publisher Full Text
-
Laity JH, Dyson HJ, Wright PE: Molecular basis for modulation of biological function by alternate splicing of the Wilms' tumor suppressor protein.
Proc Natl Acad Sci USA 2000, 97:11932-11935. PubMed Abstract | Publisher Full Text | PubMed Central Full Text
-
Peisach E, Pabo CO: Constraints for zinc finger linker design as inferred from X-ray crystal structure of tandem Zif268-DNA complexes.
J Mol Biol 2003, 330:1-7. PubMed Abstract | Publisher Full Text
-
Elrod-Erickson M, Rould MA, Nekludova L, Pabo CO: Zif268 protein-DNA complex refined at 1.6 Å: a model system for understanding zinc finger-DNA interactions.
Structure 1996, 4:1171-1180. PubMed Abstract | Publisher Full Text
-
Kim CA, Berg JM: A 2.2 Å resolution crystal structure of a designed zinc finger protein bound to DNA.
Nat Struct Biol 1996, 3:940-945. PubMed Abstract | Publisher Full Text
-
Kobe B, Kajava AV: The leucine-rich repeat as a protein recognition motif.
Curr Opin Struct Biol 2001, 11:725-732. PubMed Abstract | Publisher Full Text
-
Merz T, Wetzel SK, Firbank S, Pluckthun A, Grutter MG, Mittl PR: Stabilizing ionic interactions in a full-consensus ankyrin repeat protein.
J Mol Biol 2008, 376:232-240. PubMed Abstract | Publisher Full Text
-
McEwan PA, Scott PG, Bishop PN, Bella J: Structural correlations in the family of small leucine-rich repeat proteins and proteoglycans.
J Struct Biol 2006, 155:294-305. PubMed Abstract | Publisher Full Text
-
Monahan BJ, Villen J, Marguerat S, Bahler J, Gygi SP, Winston F: Fission yeast SWI/SNF and RSC complexes show compositional and functional differences from budding yeast.
Nat Struct Mol Biol 2008, 15:873-880. PubMed Abstract | Publisher Full Text | PubMed Central Full Text
-
Ishiguro A, Ideta M, Mikoshiba K, Chen DJ, Aruga J: Zic2-dependent transcriptional regulation is mediated by DNA-dependent protein kinase, Poly-ADP ribose polymerase, and RNA helicase A.
J Biol Chem 2007, 282:9983-9995. PubMed Abstract | Publisher Full Text
-
Aruga J, Odaka YS, Kamiya A, Furuya H: Dicyema Pax6 and Zic: tool-kit genes in a highly simplified bilaterian.
BMC Evol Biol 2007, 7:201. PubMed Abstract | BioMed Central Full Text | PubMed Central Full Text
-
Thompson JD, Gibson TJ, Plewniak F, Jeanmougin F, Higgins DG: The CLUSTAL_X windows interface: flexible strategies for multiple sequence alignment aided by quality analysis tools.
Nucleic Acids Res 1997, 25:4876-4882. PubMed Abstract | Publisher Full Text | PubMed Central Full Text
-
Schmidt HA, Strimmer K, Vingron M, von Haeseler A: TREE-PUZZLE: maximum likelihood phylogenetic analysis using quartets and parallel computing.
Bioinformatics 2002, 18:502-504. PubMed Abstract | Publisher Full Text
-
Kumar S, Nei M, Dudley J, Tamura K: MEGA: a biologist-centric software for evolutionary analysis of DNA and protein sequences.
Brief Bioinform 2008, 9:299-306. PubMed Abstract | Publisher Full Text | PubMed Central Full Text
-
Tamura K, Dudley J, Nei M, Kumar S: MEGA4: Molecular Evolutionary Genetics Analysis (MEGA) software version 4.0.
Mol Biol Evol 2007, 24:1596-1599. PubMed Abstract | Publisher Full Text
-
Stamatakis A, Hoover P, Rougemont J: A rapid bootstrap algorithm for the RAxML Web servers.
Syst Biol 2008, 57:758-771. PubMed Abstract | Publisher Full Text
-
Ronquist F, Huelsenbeck JP: MrBayes 3: Bayesian phylogenetic inference under mixed models.
Bioinformatics 2003, 19:1572-1574. PubMed Abstract | Publisher Full Text
-
Crooks GE, Hon G, Chandonia JM, Brenner SE: WebLogo: a sequence logo generator.
Genome Res 2004, 14:1188-1190. PubMed Abstract | Publisher Full Text | PubMed Central Full Text
-
Galagan JE, Henn MR, Ma LJ, Cuomo CA, Birren B: Genomics of the fungal kingdom: insights into eukaryotic biology.
Genome Res 2005, 15:1620-1631. PubMed Abstract | Publisher Full Text
-
Song J, Xu Q, Olsen R, Loomis WF, Shaulsky G, Kuspa A, Sucgang R: Comparing the Dictyostelium and Entamoeba genomes reveals an ancient split in the Conosa lineage.
PLoS Comput Biol 2005, 1:e71. PubMed Abstract | Publisher Full Text | PubMed Central Full Text
-
Archibald JM: The puzzle of plastid evolution.
Curr Biol 2009, 19:R81-88. PubMed Abstract | Publisher Full Text
