Table 5

Rotational angle prediction on the protein chains from Harrington and Ben-Tal’s work
PDB:Chain (MAAE) TM helix sequence Observed angle Predicted angle Angular error

<a onClick="popup('http://www.biomedcentral.com/1471-2105/14/304/mathml/M1','MathML',630,470);return false;" target="_blank" href="http://www.biomedcentral.com/1471-2105/14/304/mathml/M1">View MathML</a>

PDB:Chain (MAAE) TM helix sequence Observed angle Predicted angle Angular error

<a onClick="popup('http://www.biomedcentral.com/1471-2105/14/304/mathml/M2','MathML',630,470);return false;" target="_blank" href="http://www.biomedcentral.com/1471-2105/14/304/mathml/M2">View MathML</a>

1BL8:A HWRAAGAATVLLVIVLLAGSYLAVLA 199.55° 203.38° 3.83° 1.46 2H88:D VSALLLGLLPAAYLYPG 229.60° 234.10° 4.50° 1.06
(30.86) WGRCVAVVVMVAGITSFGLVTAALAT 240.88° 298.78° 57.90° 1.87 (27.22) AVDYSLAAALTLHGHWGL 8.24° 354.67° 13.57° 0.95
1C3W:A IWLALGTALMGLGTLYFLVKGMG 318.98° 355.18° 36.19° 3.38 GLYVLSAITFTGLCYFNYYDV 334.89° 271.30° 63.59° 1.49
(42.28) KFYAITTLVPAIAFTMYLSMLL 262.69° 313.32° 50.63° 2.74 2OAR:A VAVVIGTAFTALVTKFTDSIITPLINRIG 319.36° 203.39° 115.96° 0.37
WARYADWLFTTPLLLLDLALL 118.84° 44.89° 73.95° 1.60 (113.71) TIDLNVLLSAAINFFLIAFAVYFL 105.75° 354.30° 111.46° 1.06
GTILALVGADGIMIGTGLVGAL 357.99° 332.94° 25.05° 2.80 2QTS:A VWALCFMGSLALLALVCTNRIQ 285.04° 280.66° 4.38° 2.32
RFVWWAISTAAMLYILYVLFFGF 154.03° 169.74° 15.71° 2.25 (11.07) AGLLGDIGGQMGLFIGASILTVL 41.15° 23.39° 17.76° 2.22
FKVLRNVTVVLWSAYPVVWLIG 133.56° 164.23° 30.67° 2.70 2RH1:A WVVGMGIVMSLIVLAIVFGNVLVITAIA 253.60° 259.99° 6.39° 1.71
ETLLFMVLDVSAKVGFGLILLRS 214.98° 278.73° 63.75° 1.93 (35.73) YFITSLACADLVMGLAVVPFGAAHIL 293.99° 341.90° 47.91° 1.06
1OKC:A LSFLKDFLAGGVAAAISKTAVAPIER 24.46° 46.33° 21.87° 1.59 WCEFWTSIDVLCVTASIETLCVIAV 279.34° 285.10° 5.77° 0.68
(65.78) NLANVIRYFPTQALNFAFKDKYKQIFL 207.77° 114.64° 93.14° 1.75 RVIILMVWIVSGLTSFLPIQMHWYR 88.76° 102.09° 13.33° 1.93
WRYFAGNLASGGAAGATSLCFVYPLDFART 112.40° 70.30° 42.09° 1.32 FTNQAYAIASSIVSFYVPLVIMVFVYS 158.19° 84.71° 73.47° 1.88
YQGFNVSVQGIIIYRAAYFGVYDTAKGMLP 179.94° 59.44° 120.50° 1.40 LGIIMGTFTLCWLPFFIVNIVHVIQ 106.50° 159.31° 52.82° 1.40
HIIVSWMIAQTVTAVAGLVSYPFDTVRR 264.34° 315.20° 50.85° 0.98 IRKEVYILLNWIGYVNSGFNPLIYC 271.42° 321.81° 50.39° 1.50
AWSNVLRGMGGAFVLVLYDEI 172.16° 105.90° 66.25° 1.87 2UUH:A AAVTLLGVLLQAYF 60.17° 77.84° 17.67° 1.38
1ORS:C VELGVSYAALLSVIVVVVEYTMQL 268.82° 191.51° 77.31° 0.70 (10.47) SEYFPLFLATLWVAG 96.55° 80.38° 16.17° 0.77
(62.09) LVRLYLVDLILVIILWADYAY 167.76° 133.29° 34.46° 1.71 AALCGLVYLFARLR 191.79° 197.96° 6.17° 2.39
KKTLYEIPALVPAGLLALIE 27.58° 321.07° 66.51° 0.72 LYASARALWLLVALAAL 116.59° 118.45° 1.86° 2.57
LVRLLRFLRILLIISRGSKFLSAIA 233.80° 303.87° 70.07° 0.62 2Z73:A SLGIFIGICGIIGCGGNGIVIY 276.78° 317.73° 40.94° 3.01
2B6O:A RAIFAEFFATLFYVFFGLGAS 308.42° 335.32° 26.90° 1.44 (35.30) FIINLAFSDFTFSLVNGFPLMTI 206.68° 252.82° 46.14° 1.12
(33.01) LQVALAFGLALATLVQAVGHIS 59.48° 65.56° 6.07° 1.17 VYGFIGGIFGFMSIMTMAMISI 303.09° 339.23° 36.14° 0.80
LRAICYVVAQLLGAVAGAAVLYSV 354.70° 13.71° 19.01° 2.35 FIMIIFVWLWSVLWAIGPIF 99.36° 72.24° 27.11° 2.67
GQATIVEIFLTLQFVLCIFATY 61.06° 71.11° 10.05° 1.58 NILCMFILGFFGPILIIFFCYF 270.54° 293.89° 23.35° 2.49
GSVALAVGFSLTLGHLFGM 342.15° 109.29° 127.14° 1.21 SIVIVSQFLLSWSPYAVVAL 127.57° 154.75° 27.18° 2.12
WVYWVGPVIGAGLGSLLYDFLL 49.77° 58.65° 8.88° 1.58 QLPVMFAKASAIHNPMIYSV 60.63° 106.85° 46.22° 2.01
2BL2:A VLAMATATIFSGIGSAKGVG 45.15° 105.31° 60.16° 0.99 3B9W:A YSINILAMLLVGFGFLMV 232.00° 229.10° 2.90° 0.63
(41.83) LPGTQGLYGFVIAFLIFI 285.84° 259.80° 26.04° 1.70 (33.25) ATTGTYLVVATGLPLYILL 193.50° 227.23° 33.73° 0.87
LGASLPIAFTGLFSGIAQ 82.57° 87.25° 4.68° 1.39 IYAEFAVATGLIAMGAVL 221.13° 199.82° 21.31° 0.05
MVETYAILGFVISFLLVL 7.10° 290.64° 76.46° 1.13 FQYALLALFIVPVYLLNE 11.39° 35.81° 24.42° 1.15
2BS2:C WQSATGLFLGLFMIGHMFFVST 285.17° 308.25° 23.08° 1.79 GSIAIHAFGAYFGLGVSIA 208.92° 309.21° 100.29° 0.73
(51.33) IVVSFLAAFVFAVFIAHAFLAMR 55.33° 17.57° 37.76° 2.89 FSMLGSMVLWLFWPSFA 284.14° 287.41° 3.27° 1.16
LWWIQAMTGFAMFFLGSVHLYIMMTQP 188.56° 222.27° 33.71° 1.48 VNTLLALCGATLATYFLSAL 36.54° 3.47° 33.07° 1.57
WMWPLYLVLLFAVELHGSVGLYRLAV 192.12° 322.45° 130.33° 1.38 VDMANAALAGGVAIGSVC 138.00° 55.95° 82.05° 0.24
RANLKKLKTLMSAFLIVLGLLTFGAYV 185.58° 153.82° 31.76° 3.30 VGAFVIGLLGGAISVVGF 11.05° 21.65° 10.60° 1.90
2H88:C HRGTGVALSLGVSLFSLAALLLP 123.28° 203.88° 80.60° 1.69 TCGVHNLHGLPGLLGGFSAIL 112.57° 156.18° 43.61° 0.92
(45.70) LIYSAKFALVFPLSYHTWNGIR 307.08° 253.07° 54.01° 0.39 LTGIGITLALALIGGVIAGALIKLT 103.20° 92.65° 10.55° 2.58
VVVLILTLLSSAAIASE 74.04° 71.55° 2.50° 2.05

The columns are protein chain, sequences of transmembrane helices, observed rotational angles from structures, predicted rotational angles by TMexpo, angular errors, and predicted rASA moment lengths (<a onClick="popup('http://www.biomedcentral.com/1471-2105/14/304/mathml/M3','MathML',630,470);return false;" target="_blank" href="http://www.biomedcentral.com/1471-2105/14/304/mathml/M3">View MathML</a>).

Lai et al.

Lai et al. BMC Bioinformatics 2013 14:304   doi:10.1186/1471-2105-14-304

Open Data