Table 7

A fragment of the text output of this heterogeneous pipeline workflow (see Figure 14)

                   FASTAReadsMappingtoReferenceGenome_2.OutputUnmapped-1.map

>HBA_HUMAN P69905 Hemoglobin subunit alpha (Hemoglobin alpha chain) (Alpha-globin)

LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHF-DLS-----HGSAQV

>GHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPA

EFTPAVHASLDKFLASVSTVLTSKY

>HBB_HUMAN P68871 Hemoglobin subunit beta (Hemoglobin beta chain) (Beta-globin) (LVV-hemorphin-7)

LTPEEKSAVTALWGKV--NVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKV

>AHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGK

EFTPPVQAAYQKVVAGVANALAHKY


Dinov et al. BMC Bioinformatics 2011 12:304   doi:10.1186/1471-2105-12-304

Open Data